BLASTX nr result
ID: Ziziphus21_contig00016332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00016332 (264 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010097418.1| hypothetical protein L484_009642 [Morus nota... 66 9e-09 ref|XP_010112014.1| hypothetical protein L484_004701 [Morus nota... 65 2e-08 >ref|XP_010097418.1| hypothetical protein L484_009642 [Morus notabilis] gi|587879053|gb|EXB68035.1| hypothetical protein L484_009642 [Morus notabilis] Length = 462 Score = 66.2 bits (160), Expect = 9e-09 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 4/73 (5%) Frame = -2 Query: 251 TASTFSNLSFLALFKI----EDLQSLPEWLKYLTCLRNLGILSYNNLMSLSPGIQQLASS 84 T+S+FS LS L +I EDLQ LPEW K LTCL+ L I+ + L LSPGI L +S Sbjct: 237 TSSSFSPLSKLTSLRIWGIGEDLQCLPEWFKSLTCLKELEIVYCSKLKDLSPGIHHL-TS 295 Query: 83 LEGLRIDNCQQLD 45 LE L I+NC++L+ Sbjct: 296 LESLVIENCEELE 308 >ref|XP_010112014.1| hypothetical protein L484_004701 [Morus notabilis] gi|587945994|gb|EXC32359.1| hypothetical protein L484_004701 [Morus notabilis] Length = 600 Score = 65.5 bits (158), Expect = 2e-08 Identities = 38/73 (52%), Positives = 48/73 (65%), Gaps = 4/73 (5%) Frame = -2 Query: 248 ASTFSNLSFLALFKI----EDLQSLPEWLKYLTCLRNLGILSYNNLMSLSPGIQQLASSL 81 +S+FS+LS L I EDLQ LPEW K LTCL+ L I + L LSPGIQ L +SL Sbjct: 412 SSSFSSLSKLTSLTISEIGEDLQCLPEWFKSLTCLKKLEIQECSKLKDLSPGIQHL-TSL 470 Query: 80 EGLRIDNCQQLDM 42 E L I NC++L++ Sbjct: 471 EDLEIRNCEELEV 483