BLASTX nr result
ID: Ziziphus21_contig00016069
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00016069 (209 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525210.1| zinc finger protein, putative [Ricinus commu... 64 3e-08 ref|XP_008241939.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin... 63 1e-07 ref|XP_007208103.1| hypothetical protein PRUPE_ppa001024mg [Prun... 62 2e-07 ref|XP_008387695.1| PREDICTED: E3 ubiquitin-protein ligase SGR9,... 60 8e-07 ref|XP_009341921.1| PREDICTED: E3 ubiquitin-protein ligase SGR9,... 59 1e-06 ref|XP_009338574.1| PREDICTED: E3 ubiquitin-protein ligase SGR9,... 59 1e-06 ref|XP_008369820.1| PREDICTED: E3 ubiquitin-protein ligase SGR9,... 59 1e-06 ref|XP_007144501.1| hypothetical protein PHAVU_007G161400g [Phas... 59 1e-06 ref|XP_014512449.1| PREDICTED: E3 ubiquitin-protein ligase SGR9,... 57 7e-06 ref|XP_012443411.1| PREDICTED: E3 ubiquitin-protein ligase SGR9,... 57 7e-06 >ref|XP_002525210.1| zinc finger protein, putative [Ricinus communis] gi|223535507|gb|EEF37176.1| zinc finger protein, putative [Ricinus communis] Length = 275 Score = 64.3 bits (155), Expect = 3e-08 Identities = 36/69 (52%), Positives = 41/69 (59%) Frame = +2 Query: 2 EETIMASLATLTLPQLSDLTNSVFSQTXXXXXXXXXXXXXXXXXXXXXHRLHFLSLPHKT 181 E IMA+L+TLT PQLS LT+S+ SQT H LH LSLPHKT Sbjct: 4 ETMIMAALSTLTPPQLSHLTHSILSQTLHHHHSLSSLLSSPSSFSLTLHHLHSLSLPHKT 63 Query: 182 LLIARHLLS 208 LLIA+HLLS Sbjct: 64 LLIAKHLLS 72 >ref|XP_008241939.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase SGR9, amyloplastic [Prunus mume] Length = 275 Score = 62.8 bits (151), Expect = 1e-07 Identities = 35/67 (52%), Positives = 41/67 (61%) Frame = +2 Query: 8 TIMASLATLTLPQLSDLTNSVFSQTXXXXXXXXXXXXXXXXXXXXXHRLHFLSLPHKTLL 187 TIMA+LATL+ PQLSDLT+++ S T HRL+ LSLPHKTLL Sbjct: 11 TIMAALATLSPPQLSDLTHTILSHTHHHRLRLSSLLSSPILFSLTLHRLNSLSLPHKTLL 70 Query: 188 IARHLLS 208 IA HLLS Sbjct: 71 IANHLLS 77 >ref|XP_007208103.1| hypothetical protein PRUPE_ppa001024mg [Prunus persica] gi|462403745|gb|EMJ09302.1| hypothetical protein PRUPE_ppa001024mg [Prunus persica] Length = 931 Score = 62.0 bits (149), Expect = 2e-07 Identities = 34/67 (50%), Positives = 41/67 (61%) Frame = +2 Query: 8 TIMASLATLTLPQLSDLTNSVFSQTXXXXXXXXXXXXXXXXXXXXXHRLHFLSLPHKTLL 187 TIMA+LATL+ PQLSDLT+++ S T HRL+ +SLPHKTLL Sbjct: 668 TIMAALATLSPPQLSDLTHTILSHTHHHLLRLSFLLSSPILFSLTLHRLNSISLPHKTLL 727 Query: 188 IARHLLS 208 IA HLLS Sbjct: 728 IANHLLS 734 >ref|XP_008387695.1| PREDICTED: E3 ubiquitin-protein ligase SGR9, amyloplastic-like [Malus domestica] Length = 275 Score = 59.7 bits (143), Expect = 8e-07 Identities = 34/67 (50%), Positives = 39/67 (58%) Frame = +2 Query: 8 TIMASLATLTLPQLSDLTNSVFSQTXXXXXXXXXXXXXXXXXXXXXHRLHFLSLPHKTLL 187 TIMA+LATLT PQLS LT+++ S T HRL+ L LPHKTLL Sbjct: 10 TIMAALATLTPPQLSHLTHTILSHTHHHHHRLSSLLSSPILFSLTLHRLNSLPLPHKTLL 69 Query: 188 IARHLLS 208 IA HLLS Sbjct: 70 IANHLLS 76 >ref|XP_009341921.1| PREDICTED: E3 ubiquitin-protein ligase SGR9, amyloplastic-like [Pyrus x bretschneideri] Length = 273 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/67 (49%), Positives = 39/67 (58%) Frame = +2 Query: 8 TIMASLATLTLPQLSDLTNSVFSQTXXXXXXXXXXXXXXXXXXXXXHRLHFLSLPHKTLL 187 TIMA+LATLT PQLSDLT+++ T HRL+ L LPHKT+L Sbjct: 8 TIMAALATLTPPQLSDLTHTIICHTHHHHHRLSSLLSSPILFSLTLHRLNSLPLPHKTVL 67 Query: 188 IARHLLS 208 IA HLLS Sbjct: 68 IANHLLS 74 >ref|XP_009338574.1| PREDICTED: E3 ubiquitin-protein ligase SGR9, amyloplastic-like [Pyrus x bretschneideri] Length = 313 Score = 58.9 bits (141), Expect = 1e-06 Identities = 34/67 (50%), Positives = 38/67 (56%) Frame = +2 Query: 8 TIMASLATLTLPQLSDLTNSVFSQTXXXXXXXXXXXXXXXXXXXXXHRLHFLSLPHKTLL 187 TIMA+LATLT PQLSDLT ++ S T HRL+ L L HKTLL Sbjct: 49 TIMAALATLTPPQLSDLTRTILSHTHHRRRRLSSLLSSPILFSLTLHRLNCLPLAHKTLL 108 Query: 188 IARHLLS 208 IA HLLS Sbjct: 109 IANHLLS 115 >ref|XP_008369820.1| PREDICTED: E3 ubiquitin-protein ligase SGR9, amyloplastic-like [Malus domestica] Length = 334 Score = 58.9 bits (141), Expect = 1e-06 Identities = 34/67 (50%), Positives = 38/67 (56%) Frame = +2 Query: 8 TIMASLATLTLPQLSDLTNSVFSQTXXXXXXXXXXXXXXXXXXXXXHRLHFLSLPHKTLL 187 TIMA+LATLT PQLSDLT ++ S T HRL+ L L HKTLL Sbjct: 70 TIMAALATLTPPQLSDLTRTILSHTHHHHRRLSSLLSSPILFSLTLHRLNCLPLAHKTLL 129 Query: 188 IARHLLS 208 IA HLLS Sbjct: 130 IANHLLS 136 >ref|XP_007144501.1| hypothetical protein PHAVU_007G161400g [Phaseolus vulgaris] gi|561017691|gb|ESW16495.1| hypothetical protein PHAVU_007G161400g [Phaseolus vulgaris] Length = 269 Score = 58.9 bits (141), Expect = 1e-06 Identities = 34/67 (50%), Positives = 38/67 (56%) Frame = +2 Query: 8 TIMASLATLTLPQLSDLTNSVFSQTXXXXXXXXXXXXXXXXXXXXXHRLHFLSLPHKTLL 187 TIMA+L+TLT Q SDLT+S+ S T H LH LSLP KTLL Sbjct: 8 TIMAALSTLTPSQFSDLTHSILSATLYHHRRLASLLSSPTLFSLTLHHLHSLSLPQKTLL 67 Query: 188 IARHLLS 208 IARHLLS Sbjct: 68 IARHLLS 74 >ref|XP_014512449.1| PREDICTED: E3 ubiquitin-protein ligase SGR9, amyloplastic [Vigna radiata var. radiata] Length = 269 Score = 56.6 bits (135), Expect = 7e-06 Identities = 33/66 (50%), Positives = 37/66 (56%) Frame = +2 Query: 11 IMASLATLTLPQLSDLTNSVFSQTXXXXXXXXXXXXXXXXXXXXXHRLHFLSLPHKTLLI 190 IMA+L+TLT Q SDLT+S+ S T H LH LSLP KTLLI Sbjct: 9 IMAALSTLTPSQFSDLTHSILSTTLHHHRRLAFLLSSPTLFSLTLHHLHNLSLPQKTLLI 68 Query: 191 ARHLLS 208 ARHLLS Sbjct: 69 ARHLLS 74 >ref|XP_012443411.1| PREDICTED: E3 ubiquitin-protein ligase SGR9, amyloplastic [Gossypium raimondii] gi|763795546|gb|KJB62542.1| hypothetical protein B456_009G421800 [Gossypium raimondii] Length = 278 Score = 56.6 bits (135), Expect = 7e-06 Identities = 33/68 (48%), Positives = 39/68 (57%) Frame = +2 Query: 2 EETIMASLATLTLPQLSDLTNSVFSQTXXXXXXXXXXXXXXXXXXXXXHRLHFLSLPHKT 181 E TIMA+++TL QLSDL+ S+FS + HRLH LSLP KT Sbjct: 6 ETTIMAAISTLGPSQLSDLSYSIFSLSFHHRRRLCHLLSSPCLFFLTLHRLHTLSLPQKT 65 Query: 182 LLIARHLL 205 LLIARHLL Sbjct: 66 LLIARHLL 73