BLASTX nr result
ID: Ziziphus21_contig00015419
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00015419 (217 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008229233.1| PREDICTED: protein AAR2 homolog [Prunus mume] 116 7e-24 ref|XP_007215488.1| hypothetical protein PRUPE_ppa006770mg [Prun... 116 7e-24 ref|XP_007033087.1| AAR2 protein family isoform 3 [Theobroma cac... 115 1e-23 ref|XP_007033086.1| AAR2 protein family isoform 2 [Theobroma cac... 115 1e-23 ref|XP_007033085.1| AAR2 protein family isoform 1 [Theobroma cac... 115 1e-23 gb|KJB22754.1| hypothetical protein B456_004G064600 [Gossypium r... 115 1e-23 ref|XP_012473669.1| PREDICTED: protein AAR2 homolog isoform X1 [... 115 1e-23 ref|XP_004490913.1| PREDICTED: protein AAR2 homolog [Cicer ariet... 115 2e-23 ref|XP_004490901.1| PREDICTED: protein AAR2 homolog isoform X1 [... 115 2e-23 ref|XP_004490869.1| PREDICTED: protein AAR2 homolog isoform X1 [... 115 2e-23 gb|KHG05348.1| hypothetical protein F383_30716 [Gossypium arboreum] 114 4e-23 ref|XP_008365771.1| PREDICTED: protein AAR2 homolog [Malus domes... 113 6e-23 ref|XP_009371806.1| PREDICTED: protein AAR2 homolog [Pyrus x bre... 112 1e-22 gb|KDO63127.1| hypothetical protein CISIN_1g016504mg [Citrus sin... 112 1e-22 gb|KDO63126.1| hypothetical protein CISIN_1g016504mg [Citrus sin... 112 1e-22 ref|XP_006482151.1| PREDICTED: protein AAR2 homolog isoform X1 [... 112 1e-22 ref|XP_006430651.1| hypothetical protein CICLE_v10011939mg [Citr... 112 1e-22 ref|XP_006430650.1| hypothetical protein CICLE_v10011939mg [Citr... 112 1e-22 ref|XP_010097112.1| hypothetical protein L484_004898 [Morus nota... 111 2e-22 ref|XP_002534269.1| Protein C20orf4, putative [Ricinus communis]... 111 2e-22 >ref|XP_008229233.1| PREDICTED: protein AAR2 homolog [Prunus mume] Length = 434 Score = 116 bits (290), Expect = 7e-24 Identities = 54/70 (77%), Positives = 64/70 (91%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFA++AFLMGQSLEAFLQWKSLVSLLFGCT+APF TRS+LF K I+V+YYQLK GL+K Sbjct: 277 ELQFAYIAFLMGQSLEAFLQWKSLVSLLFGCTEAPFHTRSRLFAKFIRVIYYQLKQGLQK 336 Query: 35 DPTDTNAGES 6 D TDTN+G + Sbjct: 337 DCTDTNSGST 346 >ref|XP_007215488.1| hypothetical protein PRUPE_ppa006770mg [Prunus persica] gi|462411638|gb|EMJ16687.1| hypothetical protein PRUPE_ppa006770mg [Prunus persica] Length = 396 Score = 116 bits (290), Expect = 7e-24 Identities = 54/70 (77%), Positives = 64/70 (91%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFA++AFLMGQSLEAFLQWKSLVSLLFGCT+APF TRS+LF K I+V+YYQLK GL+K Sbjct: 239 ELQFAYIAFLMGQSLEAFLQWKSLVSLLFGCTEAPFHTRSRLFAKFIRVIYYQLKQGLQK 298 Query: 35 DPTDTNAGES 6 D TDTN+G + Sbjct: 299 DCTDTNSGST 308 >ref|XP_007033087.1| AAR2 protein family isoform 3 [Theobroma cacao] gi|508712116|gb|EOY04013.1| AAR2 protein family isoform 3 [Theobroma cacao] Length = 393 Score = 115 bits (289), Expect = 1e-23 Identities = 55/70 (78%), Positives = 62/70 (88%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAF+QWKSLVSLLFGCTKAPF+TRSQLFTK IKV+YYQL +GL+K Sbjct: 240 ELQFAFIAFLMGQSLEAFIQWKSLVSLLFGCTKAPFRTRSQLFTKFIKVIYYQLTYGLQK 299 Query: 35 DPTDTNAGES 6 D AG S Sbjct: 300 DSRIVEAGAS 309 >ref|XP_007033086.1| AAR2 protein family isoform 2 [Theobroma cacao] gi|508712115|gb|EOY04012.1| AAR2 protein family isoform 2 [Theobroma cacao] Length = 392 Score = 115 bits (289), Expect = 1e-23 Identities = 55/70 (78%), Positives = 62/70 (88%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAF+QWKSLVSLLFGCTKAPF+TRSQLFTK IKV+YYQL +GL+K Sbjct: 239 ELQFAFIAFLMGQSLEAFIQWKSLVSLLFGCTKAPFRTRSQLFTKFIKVIYYQLTYGLQK 298 Query: 35 DPTDTNAGES 6 D AG S Sbjct: 299 DSRIVEAGAS 308 >ref|XP_007033085.1| AAR2 protein family isoform 1 [Theobroma cacao] gi|508712114|gb|EOY04011.1| AAR2 protein family isoform 1 [Theobroma cacao] Length = 392 Score = 115 bits (289), Expect = 1e-23 Identities = 55/70 (78%), Positives = 62/70 (88%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAF+QWKSLVSLLFGCTKAPF+TRSQLFTK IKV+YYQL +GL+K Sbjct: 239 ELQFAFIAFLMGQSLEAFIQWKSLVSLLFGCTKAPFRTRSQLFTKFIKVIYYQLTYGLQK 298 Query: 35 DPTDTNAGES 6 D AG S Sbjct: 299 DSRIVEAGAS 308 >gb|KJB22754.1| hypothetical protein B456_004G064600 [Gossypium raimondii] Length = 241 Score = 115 bits (288), Expect = 1e-23 Identities = 55/70 (78%), Positives = 63/70 (90%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAF+QWKSLVSLL GCT+APFQTRSQLFTK IKV+YYQLK+GL+K Sbjct: 83 ELQFAFIAFLMGQSLEAFMQWKSLVSLLLGCTEAPFQTRSQLFTKFIKVIYYQLKYGLQK 142 Query: 35 DPTDTNAGES 6 D + AG S Sbjct: 143 DRSVGEAGTS 152 >ref|XP_012473669.1| PREDICTED: protein AAR2 homolog isoform X1 [Gossypium raimondii] gi|763755421|gb|KJB22752.1| hypothetical protein B456_004G064600 [Gossypium raimondii] Length = 398 Score = 115 bits (288), Expect = 1e-23 Identities = 55/70 (78%), Positives = 63/70 (90%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAF+QWKSLVSLL GCT+APFQTRSQLFTK IKV+YYQLK+GL+K Sbjct: 240 ELQFAFIAFLMGQSLEAFMQWKSLVSLLLGCTEAPFQTRSQLFTKFIKVIYYQLKYGLQK 299 Query: 35 DPTDTNAGES 6 D + AG S Sbjct: 300 DRSVGEAGTS 309 >ref|XP_004490913.1| PREDICTED: protein AAR2 homolog [Cicer arietinum] Length = 261 Score = 115 bits (287), Expect = 2e-23 Identities = 54/64 (84%), Positives = 61/64 (95%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAFVAFLMGQSLEAFLQWKSLVSLLFGCT+APF TR++LFTK IKV+YYQLK+GL+K Sbjct: 109 ELQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTEAPFNTRTRLFTKFIKVIYYQLKYGLQK 168 Query: 35 DPTD 24 D TD Sbjct: 169 DRTD 172 >ref|XP_004490901.1| PREDICTED: protein AAR2 homolog isoform X1 [Cicer arietinum] Length = 282 Score = 115 bits (287), Expect = 2e-23 Identities = 54/64 (84%), Positives = 61/64 (95%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAFVAFLMGQSLEAFLQWKSLVSLLFGCT+APF TR++LFTK IKV+YYQLK+GL+K Sbjct: 130 ELQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTEAPFNTRTRLFTKFIKVIYYQLKYGLQK 189 Query: 35 DPTD 24 D TD Sbjct: 190 DRTD 193 >ref|XP_004490869.1| PREDICTED: protein AAR2 homolog isoform X1 [Cicer arietinum] Length = 391 Score = 115 bits (287), Expect = 2e-23 Identities = 54/64 (84%), Positives = 61/64 (95%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAFVAFLMGQSLEAFLQWKSLVSLLFGCT+APF TR++LFTK IKV+YYQLK+GL+K Sbjct: 239 ELQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTEAPFNTRTRLFTKFIKVIYYQLKYGLQK 298 Query: 35 DPTD 24 D TD Sbjct: 299 DRTD 302 >gb|KHG05348.1| hypothetical protein F383_30716 [Gossypium arboreum] Length = 400 Score = 114 bits (284), Expect = 4e-23 Identities = 54/70 (77%), Positives = 63/70 (90%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAF+QWKSLVSLL GCT+APFQTRS+LFTK IKV+YYQLK+GL+K Sbjct: 242 ELQFAFIAFLMGQSLEAFMQWKSLVSLLLGCTEAPFQTRSRLFTKFIKVIYYQLKYGLQK 301 Query: 35 DPTDTNAGES 6 D + AG S Sbjct: 302 DRSVGEAGTS 311 >ref|XP_008365771.1| PREDICTED: protein AAR2 homolog [Malus domestica] Length = 275 Score = 113 bits (282), Expect = 6e-23 Identities = 54/70 (77%), Positives = 61/70 (87%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAFLQWKSLVSLLFGCT+APF+TRSQLF K IKV+YYQLK GL+K Sbjct: 118 ELQFAFIAFLMGQSLEAFLQWKSLVSLLFGCTEAPFRTRSQLFAKFIKVIYYQLKHGLQK 177 Query: 35 DPTDTNAGES 6 DT+ S Sbjct: 178 GCADTSVASS 187 >ref|XP_009371806.1| PREDICTED: protein AAR2 homolog [Pyrus x bretschneideri] Length = 416 Score = 112 bits (279), Expect = 1e-22 Identities = 54/70 (77%), Positives = 61/70 (87%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAFLQWKSLVSLLFGCT+APF+TRS LF K IKV+YYQLK GL+K Sbjct: 259 ELQFAFIAFLMGQSLEAFLQWKSLVSLLFGCTEAPFRTRSLLFAKFIKVIYYQLKHGLQK 318 Query: 35 DPTDTNAGES 6 TDT+ S Sbjct: 319 GCTDTSIASS 328 >gb|KDO63127.1| hypothetical protein CISIN_1g016504mg [Citrus sinensis] Length = 355 Score = 112 bits (279), Expect = 1e-22 Identities = 53/70 (75%), Positives = 60/70 (85%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAFLQWKSLVSLLFGC++AP TRSQLFT IKV+YYQLK+GL+K Sbjct: 239 ELQFAFIAFLMGQSLEAFLQWKSLVSLLFGCSEAPLHTRSQLFTMFIKVIYYQLKYGLQK 298 Query: 35 DPTDTNAGES 6 D T G S Sbjct: 299 DRNGTETGAS 308 >gb|KDO63126.1| hypothetical protein CISIN_1g016504mg [Citrus sinensis] Length = 388 Score = 112 bits (279), Expect = 1e-22 Identities = 53/70 (75%), Positives = 60/70 (85%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAFLQWKSLVSLLFGC++AP TRSQLFT IKV+YYQLK+GL+K Sbjct: 239 ELQFAFIAFLMGQSLEAFLQWKSLVSLLFGCSEAPLHTRSQLFTMFIKVIYYQLKYGLQK 298 Query: 35 DPTDTNAGES 6 D T G S Sbjct: 299 DRNGTETGAS 308 >ref|XP_006482151.1| PREDICTED: protein AAR2 homolog isoform X1 [Citrus sinensis] gi|568857195|ref|XP_006482152.1| PREDICTED: protein AAR2 homolog isoform X2 [Citrus sinensis] Length = 388 Score = 112 bits (279), Expect = 1e-22 Identities = 53/70 (75%), Positives = 60/70 (85%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAFLQWKSLVSLLFGC++AP TRSQLFT IKV+YYQLK+GL+K Sbjct: 239 ELQFAFIAFLMGQSLEAFLQWKSLVSLLFGCSEAPLHTRSQLFTMFIKVIYYQLKYGLQK 298 Query: 35 DPTDTNAGES 6 D T G S Sbjct: 299 DRNGTETGAS 308 >ref|XP_006430651.1| hypothetical protein CICLE_v10011939mg [Citrus clementina] gi|557532708|gb|ESR43891.1| hypothetical protein CICLE_v10011939mg [Citrus clementina] Length = 356 Score = 112 bits (279), Expect = 1e-22 Identities = 53/70 (75%), Positives = 60/70 (85%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAFLQWKSLVSLLFGC++AP TRSQLFT IKV+YYQLK+GL+K Sbjct: 207 ELQFAFIAFLMGQSLEAFLQWKSLVSLLFGCSEAPLHTRSQLFTMFIKVIYYQLKYGLQK 266 Query: 35 DPTDTNAGES 6 D T G S Sbjct: 267 DRNGTETGAS 276 >ref|XP_006430650.1| hypothetical protein CICLE_v10011939mg [Citrus clementina] gi|557532707|gb|ESR43890.1| hypothetical protein CICLE_v10011939mg [Citrus clementina] Length = 388 Score = 112 bits (279), Expect = 1e-22 Identities = 53/70 (75%), Positives = 60/70 (85%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAFLQWKSLVSLLFGC++AP TRSQLFT IKV+YYQLK+GL+K Sbjct: 239 ELQFAFIAFLMGQSLEAFLQWKSLVSLLFGCSEAPLHTRSQLFTMFIKVIYYQLKYGLQK 298 Query: 35 DPTDTNAGES 6 D T G S Sbjct: 299 DRNGTETGAS 308 >ref|XP_010097112.1| hypothetical protein L484_004898 [Morus notabilis] gi|587877954|gb|EXB66973.1| hypothetical protein L484_004898 [Morus notabilis] Length = 397 Score = 111 bits (277), Expect = 2e-22 Identities = 53/65 (81%), Positives = 59/65 (90%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAFVAFLMGQSLEAFLQWKSLVSLLF CT+APF TRSQLF K IKV+Y+QLK+GL+K Sbjct: 239 ELQFAFVAFLMGQSLEAFLQWKSLVSLLFECTEAPFHTRSQLFVKFIKVIYFQLKYGLQK 298 Query: 35 DPTDT 21 D DT Sbjct: 299 DSPDT 303 >ref|XP_002534269.1| Protein C20orf4, putative [Ricinus communis] gi|223525600|gb|EEF28112.1| Protein C20orf4, putative [Ricinus communis] Length = 409 Score = 111 bits (277), Expect = 2e-22 Identities = 51/66 (77%), Positives = 60/66 (90%) Frame = -3 Query: 215 EMQFAFVAFLMGQSLEAFLQWKSLVSLLFGCTKAPFQTRSQLFTKVIKVVYYQLKFGLRK 36 E+QFAF+AFLMGQSLEAF QWKSLVSLL GCT+AP +TRS+LFTK IKV+YYQLK+GL+K Sbjct: 244 ELQFAFIAFLMGQSLEAFFQWKSLVSLLLGCTEAPLRTRSRLFTKFIKVIYYQLKYGLQK 303 Query: 35 DPTDTN 18 D +TN Sbjct: 304 DKAETN 309