BLASTX nr result
ID: Ziziphus21_contig00015296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00015296 (298 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007020070.1| Phosphoinositide phosphatase family protein ... 58 2e-06 ref|XP_007020068.1| Phosphoinositide phosphatase family protein ... 58 2e-06 >ref|XP_007020070.1| Phosphoinositide phosphatase family protein isoform 3 [Theobroma cacao] gi|508725398|gb|EOY17295.1| Phosphoinositide phosphatase family protein isoform 3 [Theobroma cacao] Length = 751 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 297 LWELDSDYYLHVSGIGDDIFLEMCSNDNAK 208 LWELDSDYYLHVSGIGDD+F E C DNAK Sbjct: 590 LWELDSDYYLHVSGIGDDLFPEKCVEDNAK 619 >ref|XP_007020068.1| Phosphoinositide phosphatase family protein isoform 1 [Theobroma cacao] gi|590603686|ref|XP_007020069.1| Phosphoinositide phosphatase family protein isoform 1 [Theobroma cacao] gi|508725396|gb|EOY17293.1| Phosphoinositide phosphatase family protein isoform 1 [Theobroma cacao] gi|508725397|gb|EOY17294.1| Phosphoinositide phosphatase family protein isoform 1 [Theobroma cacao] Length = 911 Score = 58.2 bits (139), Expect = 2e-06 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 297 LWELDSDYYLHVSGIGDDIFLEMCSNDNAK 208 LWELDSDYYLHVSGIGDD+F E C DNAK Sbjct: 635 LWELDSDYYLHVSGIGDDLFPEKCVEDNAK 664