BLASTX nr result
ID: Ziziphus21_contig00015152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00015152 (345 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008380716.1| PREDICTED: uncharacterized protein LOC103443... 84 3e-14 ref|XP_007215906.1| hypothetical protein PRUPE_ppa004150mg [Prun... 84 5e-14 ref|XP_008372913.1| PREDICTED: uncharacterized protein LOC103436... 82 1e-13 gb|KCW56440.1| hypothetical protein EUGRSUZ_I02168 [Eucalyptus g... 82 1e-13 ref|XP_010033639.1| PREDICTED: uncharacterized protein LOC104422... 82 1e-13 ref|XP_013640429.1| PREDICTED: uncharacterized protein LOC106345... 81 3e-13 ref|XP_013588175.1| PREDICTED: uncharacterized protein LOC106296... 81 3e-13 ref|XP_009609850.1| PREDICTED: uncharacterized protein LOC104103... 81 3e-13 ref|XP_009147582.1| PREDICTED: uncharacterized protein LOC103871... 81 3e-13 emb|CDY24074.1| BnaA06g00720D [Brassica napus] 81 3e-13 ref|XP_013662923.1| PREDICTED: uncharacterized protein LOC106367... 81 3e-13 ref|XP_004303772.1| PREDICTED: uncharacterized protein LOC101299... 81 3e-13 ref|XP_009796491.1| PREDICTED: uncharacterized protein LOC104243... 81 3e-13 ref|XP_008465040.1| PREDICTED: uncharacterized protein LOC103502... 81 3e-13 gb|KDO53745.1| hypothetical protein CISIN_1g008526mg [Citrus sin... 81 3e-13 ref|XP_006465793.1| PREDICTED: uncharacterized protein LOC102617... 81 3e-13 ref|XP_006426814.1| hypothetical protein CICLE_v10025289mg [Citr... 81 3e-13 emb|CAE30293.1| GDP-fucose protein-O-fucosyltransferase 2 [Solan... 80 5e-13 ref|XP_010096529.1| hypothetical protein L484_017982 [Morus nota... 80 5e-13 ref|XP_010476871.1| PREDICTED: uncharacterized protein LOC104756... 80 5e-13 >ref|XP_008380716.1| PREDICTED: uncharacterized protein LOC103443616 [Malus domestica] Length = 586 Score = 84.3 bits (207), Expect = 3e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDILRLRKDWGSASLCDEYLCQGE PNFIA+NE Sbjct: 547 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEDPNFIAENE 586 >ref|XP_007215906.1| hypothetical protein PRUPE_ppa004150mg [Prunus persica] gi|462412056|gb|EMJ17105.1| hypothetical protein PRUPE_ppa004150mg [Prunus persica] Length = 526 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDILRLRKDWGSASLCDEYLCQGE PNF+A+NE Sbjct: 487 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEDPNFLAENE 526 >ref|XP_008372913.1| PREDICTED: uncharacterized protein LOC103436268 [Malus domestica] Length = 584 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADN 227 ASGSTFTEDILRLRKDWGSASLCDEYLCQGE PNFIA+N Sbjct: 542 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEDPNFIAEN 580 >gb|KCW56440.1| hypothetical protein EUGRSUZ_I02168 [Eucalyptus grandis] Length = 583 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDILRLRKDWGSAS CDEYLCQGE+PNFIAD+E Sbjct: 544 ASGSTFTEDILRLRKDWGSASRCDEYLCQGEEPNFIADDE 583 >ref|XP_010033639.1| PREDICTED: uncharacterized protein LOC104422884 [Eucalyptus grandis] gi|629086983|gb|KCW53340.1| hypothetical protein EUGRSUZ_J02587 [Eucalyptus grandis] Length = 580 Score = 82.4 bits (202), Expect = 1e-13 Identities = 37/40 (92%), Positives = 38/40 (95%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDILRLRKDWGSAS+CDEYLCQGE PNFIA NE Sbjct: 541 ASGSTFTEDILRLRKDWGSASICDEYLCQGEDPNFIAGNE 580 >ref|XP_013640429.1| PREDICTED: uncharacterized protein LOC106345795 [Brassica napus] gi|923638583|ref|XP_013640438.1| PREDICTED: uncharacterized protein LOC106345803 [Brassica napus] Length = 543 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDILRLRKDWG+AS+CDEYLCQ EQPNFIAD+E Sbjct: 504 ASGSTFTEDILRLRKDWGTASVCDEYLCQNEQPNFIADHE 543 >ref|XP_013588175.1| PREDICTED: uncharacterized protein LOC106296563 [Brassica oleracea var. oleracea] Length = 540 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDILRLRKDWG+AS+CDEYLCQ EQPNFIAD+E Sbjct: 501 ASGSTFTEDILRLRKDWGTASVCDEYLCQNEQPNFIADHE 540 >ref|XP_009609850.1| PREDICTED: uncharacterized protein LOC104103642 [Nicotiana tomentosiformis] gi|697111954|ref|XP_009609851.1| PREDICTED: uncharacterized protein LOC104103642 [Nicotiana tomentosiformis] Length = 554 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 337 GSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 GSTFTEDILRLRKDWGSASLCDEYLCQGE+PNFIAD+E Sbjct: 517 GSTFTEDILRLRKDWGSASLCDEYLCQGERPNFIADDE 554 >ref|XP_009147582.1| PREDICTED: uncharacterized protein LOC103871110 [Brassica rapa] Length = 543 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDILRLRKDWG+AS+CDEYLCQ EQPNFIAD+E Sbjct: 504 ASGSTFTEDILRLRKDWGTASVCDEYLCQNEQPNFIADHE 543 >emb|CDY24074.1| BnaA06g00720D [Brassica napus] Length = 544 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDILRLRKDWG+AS+CDEYLCQ EQPNFIAD+E Sbjct: 505 ASGSTFTEDILRLRKDWGTASVCDEYLCQNEQPNFIADHE 544 >ref|XP_013662923.1| PREDICTED: uncharacterized protein LOC106367650 [Brassica napus] gi|674896252|emb|CDY36604.1| BnaC06g06570D [Brassica napus] Length = 543 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDILRLRKDWG+AS+CDEYLCQ EQPNFIAD+E Sbjct: 504 ASGSTFTEDILRLRKDWGTASVCDEYLCQNEQPNFIADHE 543 >ref|XP_004303772.1| PREDICTED: uncharacterized protein LOC101299396 [Fragaria vesca subsp. vesca] Length = 556 Score = 81.3 bits (199), Expect = 3e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDILRLRK WGSAS+CDEYLCQGE+PNFIA+NE Sbjct: 517 ASGSTFTEDILRLRKGWGSASVCDEYLCQGEEPNFIAENE 556 >ref|XP_009796491.1| PREDICTED: uncharacterized protein LOC104243063 [Nicotiana sylvestris] Length = 555 Score = 80.9 bits (198), Expect = 3e-13 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 +SGSTFT+DILRLRKDWGSASLCDEYLCQGE PNFIAD+E Sbjct: 516 SSGSTFTDDILRLRKDWGSASLCDEYLCQGELPNFIADDE 555 >ref|XP_008465040.1| PREDICTED: uncharacterized protein LOC103502751 [Cucumis melo] Length = 628 Score = 80.9 bits (198), Expect = 3e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 A GSTFTEDILRLRKDWG+ASLCDEYLCQGE+PNFI++NE Sbjct: 589 APGSTFTEDILRLRKDWGTASLCDEYLCQGEEPNFISENE 628 >gb|KDO53745.1| hypothetical protein CISIN_1g008526mg [Citrus sinensis] Length = 563 Score = 80.9 bits (198), Expect = 3e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDI+RLRKDWGS SLCDEYLCQGE+PNFIA++E Sbjct: 524 ASGSTFTEDIMRLRKDWGSTSLCDEYLCQGEEPNFIAEDE 563 >ref|XP_006465793.1| PREDICTED: uncharacterized protein LOC102617227 [Citrus sinensis] Length = 563 Score = 80.9 bits (198), Expect = 3e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDI+RLRKDWGS SLCDEYLCQGE+PNFIA++E Sbjct: 524 ASGSTFTEDIMRLRKDWGSTSLCDEYLCQGEEPNFIAEDE 563 >ref|XP_006426814.1| hypothetical protein CICLE_v10025289mg [Citrus clementina] gi|557528804|gb|ESR40054.1| hypothetical protein CICLE_v10025289mg [Citrus clementina] Length = 563 Score = 80.9 bits (198), Expect = 3e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDI+RLRKDWGS SLCDEYLCQGE+PNFIA++E Sbjct: 524 ASGSTFTEDIMRLRKDWGSTSLCDEYLCQGEEPNFIAEDE 563 >emb|CAE30293.1| GDP-fucose protein-O-fucosyltransferase 2 [Solanum tuberosum] Length = 337 Score = 80.5 bits (197), Expect = 5e-13 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 +SGSTFT+DILRLRKDWGSASLCDEYLCQGE PNF+AD+E Sbjct: 298 SSGSTFTDDILRLRKDWGSASLCDEYLCQGELPNFVADDE 337 >ref|XP_010096529.1| hypothetical protein L484_017982 [Morus notabilis] gi|587875540|gb|EXB64649.1| hypothetical protein L484_017982 [Morus notabilis] Length = 578 Score = 80.5 bits (197), Expect = 5e-13 Identities = 35/40 (87%), Positives = 38/40 (95%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 A GSTFTEDILRLRKDWGSAS CD+YLCQGE+PNF+ADNE Sbjct: 539 APGSTFTEDILRLRKDWGSASSCDKYLCQGEEPNFVADNE 578 >ref|XP_010476871.1| PREDICTED: uncharacterized protein LOC104756057 [Camelina sativa] Length = 579 Score = 80.5 bits (197), Expect = 5e-13 Identities = 34/40 (85%), Positives = 40/40 (100%) Frame = -3 Query: 343 ASGSTFTEDILRLRKDWGSASLCDEYLCQGEQPNFIADNE 224 ASGSTFTEDILRLRKDWG++S+CDEYLC+GE+PNFIA+NE Sbjct: 540 ASGSTFTEDILRLRKDWGTSSMCDEYLCRGEEPNFIAENE 579