BLASTX nr result
ID: Ziziphus21_contig00015058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00015058 (242 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007210738.1| hypothetical protein PRUPE_ppa021696mg [Prun... 84 5e-14 ref|XP_012079987.1| PREDICTED: ferric reduction oxidase 8, mitoc... 81 4e-13 gb|ADR70889.1| ferric reductase oxidase [Manihot esculenta] 80 6e-13 ref|XP_010102484.1| Ferric reduction oxidase 8 [Morus notabilis]... 79 1e-12 ref|XP_008373358.1| PREDICTED: ferric reduction oxidase 8, mitoc... 78 2e-12 ref|XP_008373357.1| PREDICTED: ferric reduction oxidase 8, mitoc... 78 2e-12 ref|XP_002318065.1| ferric reductase-like transmembrane componen... 77 5e-12 gb|KDO69497.1| hypothetical protein CISIN_1g005126mg [Citrus sin... 77 7e-12 gb|KDO69496.1| hypothetical protein CISIN_1g005126mg [Citrus sin... 77 7e-12 ref|XP_006476874.1| PREDICTED: ferric reduction oxidase 8, mitoc... 77 7e-12 ref|XP_006439912.1| hypothetical protein CICLE_v10019061mg [Citr... 77 7e-12 ref|XP_011464152.1| PREDICTED: ferric reduction oxidase 8, mitoc... 76 9e-12 ref|XP_013457758.1| oxidoreductase/ferric-chelate reductase [Med... 76 9e-12 ref|XP_002511330.1| ferric-chelate reductase, putative [Ricinus ... 76 1e-11 ref|XP_011047810.1| PREDICTED: ferric reduction oxidase 8, mitoc... 72 1e-10 gb|KRH03226.1| hypothetical protein GLYMA_17G085100 [Glycine max] 72 2e-10 gb|KHG18909.1| Ferric reduction oxidase 8, mitochondrial -like p... 72 2e-10 ref|XP_007036321.1| Ferric reduction oxidase 8 isoform 1 [Theobr... 72 2e-10 ref|XP_003549599.1| PREDICTED: ferric reduction oxidase 8, mitoc... 72 2e-10 ref|XP_010663103.1| PREDICTED: ferric reduction oxidase 8, mitoc... 71 3e-10 >ref|XP_007210738.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica] gi|462406473|gb|EMJ11937.1| hypothetical protein PRUPE_ppa021696mg [Prunus persica] Length = 687 Score = 83.6 bits (205), Expect = 5e-14 Identities = 34/51 (66%), Positives = 46/51 (90%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 MA+++LL LK+++ILI+AAW+S W+LKPTQLWTRKWK AED+++ TVFGY Sbjct: 1 MANSTLLVALKILLILIFAAWVSLWLLKPTQLWTRKWKAAEDKARATVFGY 51 >ref|XP_012079987.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Jatropha curcas] gi|643720772|gb|KDP31036.1| hypothetical protein JCGZ_11412 [Jatropha curcas] Length = 724 Score = 80.9 bits (198), Expect = 4e-13 Identities = 32/51 (62%), Positives = 43/51 (84%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 MA LL +LK++M+LI+A W+S W+LKPT LWTRKWK+AED ++PT+FGY Sbjct: 1 MAKYILLAVLKILMLLIFAGWVSLWLLKPTNLWTRKWKEAEDSARPTIFGY 51 >gb|ADR70889.1| ferric reductase oxidase [Manihot esculenta] Length = 722 Score = 80.1 bits (196), Expect = 6e-13 Identities = 31/51 (60%), Positives = 44/51 (86%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 MA++ LL++LK++M+LI+A W+S W+LKPT LWTRKWK ED ++PT+FGY Sbjct: 1 MANSILLSILKLLMVLIFAGWVSLWLLKPTNLWTRKWKGVEDSARPTIFGY 51 >ref|XP_010102484.1| Ferric reduction oxidase 8 [Morus notabilis] gi|587905386|gb|EXB93548.1| Ferric reduction oxidase 8 [Morus notabilis] Length = 711 Score = 79.3 bits (194), Expect = 1e-12 Identities = 33/51 (64%), Positives = 43/51 (84%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 MA+ LL +LKV+MILI+A WIS W+LKPTQ+WTRKWK+ E+R +PT+ GY Sbjct: 1 MAEVFLLIVLKVVMILIFAGWISLWLLKPTQIWTRKWKEVEERLRPTILGY 51 >ref|XP_008373358.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform X2 [Malus domestica] Length = 699 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 MA ++LL +LK +M LI+AAWIS W+LKPTQLWT+KWK AED ++ TVFGY Sbjct: 1 MAKSTLLFVLKALMALIFAAWISLWLLKPTQLWTKKWKGAEDAARNTVFGY 51 >ref|XP_008373357.1| PREDICTED: ferric reduction oxidase 8, mitochondrial isoform X1 [Malus domestica] Length = 706 Score = 78.2 bits (191), Expect = 2e-12 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 MA ++LL +LK +M LI+AAWIS W+LKPTQLWT+KWK AED ++ TVFGY Sbjct: 1 MAKSTLLFVLKALMALIFAAWISLWLLKPTQLWTKKWKGAEDAARNTVFGY 51 >ref|XP_002318065.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] gi|222858738|gb|EEE96285.1| ferric reductase-like transmembrane component family protein [Populus trichocarpa] Length = 743 Score = 77.0 bits (188), Expect = 5e-12 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 MA LL LLKV+MI+I+A WI+ W+LKPT LWTRKWK AED ++ TVFGY Sbjct: 1 MAKAILLALLKVLMIIIFAGWIALWLLKPTNLWTRKWKGAEDSARHTVFGY 51 >gb|KDO69497.1| hypothetical protein CISIN_1g005126mg [Citrus sinensis] Length = 713 Score = 76.6 bits (187), Expect = 7e-12 Identities = 31/49 (63%), Positives = 42/49 (85%) Frame = -1 Query: 152 DNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 +N+ L +LK++MILI AAWI+ WILKPT LWT+ W +AEDR++PT+FGY Sbjct: 2 ENTALVILKMLMILICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGY 50 >gb|KDO69496.1| hypothetical protein CISIN_1g005126mg [Citrus sinensis] Length = 672 Score = 76.6 bits (187), Expect = 7e-12 Identities = 31/49 (63%), Positives = 42/49 (85%) Frame = -1 Query: 152 DNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 +N+ L +LK++MILI AAWI+ WILKPT LWT+ W +AEDR++PT+FGY Sbjct: 2 ENTALVILKMLMILICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGY 50 >ref|XP_006476874.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Citrus sinensis] Length = 713 Score = 76.6 bits (187), Expect = 7e-12 Identities = 31/49 (63%), Positives = 42/49 (85%) Frame = -1 Query: 152 DNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 +N+ L +LK++MILI AAWI+ WILKPT LWT+ W +AEDR++PT+FGY Sbjct: 2 ENTTLVILKMLMILICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGY 50 >ref|XP_006439912.1| hypothetical protein CICLE_v10019061mg [Citrus clementina] gi|557542174|gb|ESR53152.1| hypothetical protein CICLE_v10019061mg [Citrus clementina] Length = 713 Score = 76.6 bits (187), Expect = 7e-12 Identities = 31/49 (63%), Positives = 42/49 (85%) Frame = -1 Query: 152 DNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 +N+ L +LK++MILI AAWI+ WILKPT LWT+ W +AEDR++PT+FGY Sbjct: 2 ENTALVILKMLMILICAAWIALWILKPTNLWTKIWHEAEDRARPTLFGY 50 >ref|XP_011464152.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Fragaria vesca subsp. vesca] Length = 703 Score = 76.3 bits (186), Expect = 9e-12 Identities = 31/51 (60%), Positives = 42/51 (82%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 MA +L +LKV+M LI+AAW+S W++KPTQ WTR+WK AED ++PT+FGY Sbjct: 1 MARTTLPAVLKVLMALIFAAWVSLWLIKPTQFWTREWKAAEDLARPTLFGY 51 >ref|XP_013457758.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula] gi|657390223|gb|KEH31789.1| oxidoreductase/ferric-chelate reductase [Medicago truncatula] Length = 714 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 MA ++LLT+LK+M+I I AAWIS WILKPTQ+WT+KWK E + T+FGY Sbjct: 1 MASSTLLTILKLMIIFICAAWISLWILKPTQVWTKKWKHVEQSANNTIFGY 51 >ref|XP_002511330.1| ferric-chelate reductase, putative [Ricinus communis] gi|223550445|gb|EEF51932.1| ferric-chelate reductase, putative [Ricinus communis] Length = 726 Score = 75.9 bits (185), Expect = 1e-11 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 MA L +LKV+MIL++A W++ WILKPT LWTRKWK+AED ++ TVFGY Sbjct: 1 MAKAVPLAILKVLMILLFAGWVAIWILKPTNLWTRKWKEAEDSARSTVFGY 51 >ref|XP_011047810.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Populus euphratica] gi|743908701|ref|XP_011047811.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Populus euphratica] Length = 733 Score = 72.4 bits (176), Expect = 1e-10 Identities = 31/58 (53%), Positives = 41/58 (70%) Frame = -1 Query: 179 WQQSLANMADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 ++ + M LL LLKV+MI+I+A WI+ W+LKPT LWT KWK AED ++ VFGY Sbjct: 3 YRSEIVAMTKAILLALLKVLMIIIFAGWIALWLLKPTDLWTSKWKGAEDSARHAVFGY 60 >gb|KRH03226.1| hypothetical protein GLYMA_17G085100 [Glycine max] Length = 666 Score = 71.6 bits (174), Expect = 2e-10 Identities = 26/44 (59%), Positives = 38/44 (86%) Frame = -1 Query: 137 TLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 ++LK+++I ++A W+S W+LKPTQ+WTRKWKQAED + T+FGY Sbjct: 10 SILKLLIIFLFAGWVSLWLLKPTQIWTRKWKQAEDSANDTIFGY 53 >gb|KHG18909.1| Ferric reduction oxidase 8, mitochondrial -like protein [Gossypium arboreum] Length = 727 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/51 (60%), Positives = 39/51 (76%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 M +++ LLKV+MILI AW+S W+LKPT LWTRKWK AE ++ TVFGY Sbjct: 1 MGKAAVVILLKVLMILISTAWLSLWLLKPTNLWTRKWKAAESSARNTVFGY 51 >ref|XP_007036321.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao] gi|508773566|gb|EOY20822.1| Ferric reduction oxidase 8 isoform 1 [Theobroma cacao] Length = 720 Score = 71.6 bits (174), Expect = 2e-10 Identities = 31/51 (60%), Positives = 38/51 (74%) Frame = -1 Query: 158 MADNSLLTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 M S+LT+LKV+M+LI WIS W+LKPT WTRKWK AE ++ TVFGY Sbjct: 1 MGKASILTVLKVLMVLISTGWISLWLLKPTNFWTRKWKGAEASAQDTVFGY 51 >ref|XP_003549599.1| PREDICTED: ferric reduction oxidase 8, mitochondrial-like [Glycine max] gi|734367772|gb|KHN18418.1| Ferric reduction oxidase 8, mitochondrial [Glycine soja] gi|947053772|gb|KRH03225.1| hypothetical protein GLYMA_17G085100 [Glycine max] Length = 711 Score = 71.6 bits (174), Expect = 2e-10 Identities = 26/44 (59%), Positives = 38/44 (86%) Frame = -1 Query: 137 TLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 ++LK+++I ++A W+S W+LKPTQ+WTRKWKQAED + T+FGY Sbjct: 10 SILKLLIIFLFAGWVSLWLLKPTQIWTRKWKQAEDSANDTIFGY 53 >ref|XP_010663103.1| PREDICTED: ferric reduction oxidase 8, mitochondrial [Vitis vinifera] Length = 725 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -1 Query: 140 LTLLKVMMILIWAAWISFWILKPTQLWTRKWKQAEDRSKPTVFGY 6 L +LK++MILI A WI+ WILKPTQLWT+KW AED ++ TVFGY Sbjct: 6 LLILKLLMILICAGWITLWILKPTQLWTKKWHTAEDSARTTVFGY 50