BLASTX nr result
ID: Ziziphus21_contig00012417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00012417 (218 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004297009.1| PREDICTED: Werner Syndrome-like exonuclease ... 60 6e-07 ref|XP_011462822.1| PREDICTED: Werner Syndrome-like exonuclease ... 60 8e-07 ref|XP_008222813.1| PREDICTED: Werner Syndrome-like exonuclease ... 58 3e-06 ref|XP_008222811.1| PREDICTED: Werner Syndrome-like exonuclease ... 57 4e-06 >ref|XP_004297009.1| PREDICTED: Werner Syndrome-like exonuclease isoform X2 [Fragaria vesca subsp. vesca] Length = 298 Score = 60.1 bits (144), Expect = 6e-07 Identities = 34/57 (59%), Positives = 37/57 (64%), Gaps = 14/57 (24%) Frame = -1 Query: 131 LPSSIPAFQDPNPFSLSPCR--------------GQITYSRTVVEVEAAAMELLKTV 3 LPSSI A Q PN F+LSPCR GQITYSRT VEVE AAM++LKTV Sbjct: 69 LPSSILALQHPNAFALSPCRQANTRMRYPVLKFGGQITYSRTTVEVEKAAMDILKTV 125 >ref|XP_011462822.1| PREDICTED: Werner Syndrome-like exonuclease isoform X1 [Fragaria vesca subsp. vesca] Length = 299 Score = 59.7 bits (143), Expect = 8e-07 Identities = 34/58 (58%), Positives = 37/58 (63%), Gaps = 15/58 (25%) Frame = -1 Query: 131 LPSSIPAFQDPNPFSLSPCR---------------GQITYSRTVVEVEAAAMELLKTV 3 LPSSI A Q PN F+LSPCR GQITYSRT VEVE AAM++LKTV Sbjct: 69 LPSSILALQHPNAFALSPCRQAANTRMRYPVLKFGGQITYSRTTVEVEKAAMDILKTV 126 >ref|XP_008222813.1| PREDICTED: Werner Syndrome-like exonuclease isoform X2 [Prunus mume] Length = 319 Score = 57.8 bits (138), Expect = 3e-06 Identities = 32/57 (56%), Positives = 36/57 (63%), Gaps = 14/57 (24%) Frame = -1 Query: 131 LPSSIPAFQDPNPFSLSPCR--------------GQITYSRTVVEVEAAAMELLKTV 3 LPSS+ A Q PN FSLSPCR GQITYSRT V+VE AAME+LK + Sbjct: 79 LPSSVLALQHPNAFSLSPCRQANIRMRYPVMKFGGQITYSRTAVQVEKAAMEVLKII 135 >ref|XP_008222811.1| PREDICTED: Werner Syndrome-like exonuclease isoform X1 [Prunus mume] gi|645232320|ref|XP_008222812.1| PREDICTED: Werner Syndrome-like exonuclease isoform X1 [Prunus mume] Length = 320 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/58 (55%), Positives = 36/58 (62%), Gaps = 15/58 (25%) Frame = -1 Query: 131 LPSSIPAFQDPNPFSLSPCR---------------GQITYSRTVVEVEAAAMELLKTV 3 LPSS+ A Q PN FSLSPCR GQITYSRT V+VE AAME+LK + Sbjct: 79 LPSSVLALQHPNAFSLSPCRQAANIRMRYPVMKFGGQITYSRTAVQVEKAAMEVLKII 136