BLASTX nr result
ID: Ziziphus21_contig00012279
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00012279 (298 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096770.1| hypothetical protein L484_025888 [Morus nota... 57 7e-06 >ref|XP_010096770.1| hypothetical protein L484_025888 [Morus notabilis] gi|587876535|gb|EXB65622.1| hypothetical protein L484_025888 [Morus notabilis] Length = 146 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -2 Query: 297 VVQAQTSPNAPDEKYTTLFSDENPNACSIM 208 VVQA SPNAPDEK+T++FSDENPNACSIM Sbjct: 117 VVQALPSPNAPDEKFTSMFSDENPNACSIM 146