BLASTX nr result
ID: Ziziphus21_contig00012043
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00012043 (375 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005647960.1| hypothetical protein COCSUDRAFT_65904 [Cocco... 77 7e-12 ref|XP_001776952.1| predicted protein [Physcomitrella patens] gi... 68 3e-09 ref|XP_001768071.1| predicted protein [Physcomitrella patens] gi... 66 9e-09 ref|XP_001696125.1| stress-related chlorophyll a/b binding prote... 58 3e-06 >ref|XP_005647960.1| hypothetical protein COCSUDRAFT_65904 [Coccomyxa subellipsoidea C-169] gi|384249936|gb|EIE23416.1| hypothetical protein COCSUDRAFT_65904 [Coccomyxa subellipsoidea C-169] Length = 248 Score = 76.6 bits (187), Expect = 7e-12 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = -1 Query: 168 PKESAVPNDVISYAKSLPGISQPFPQLFDPFNLLGNAAGTKDGVNEVKRWRESELT 1 P ++A P+D+++YAK+LPGISQPFP +FDP NLL NA + EVKRWRESE+T Sbjct: 45 PSKAATPDDILAYAKTLPGISQPFPDIFDPANLLSNAT----SIQEVKRWRESEIT 96 >ref|XP_001776952.1| predicted protein [Physcomitrella patens] gi|162671653|gb|EDQ58201.1| predicted protein [Physcomitrella patens] Length = 244 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/61 (45%), Positives = 40/61 (65%) Frame = -1 Query: 183 SDPIPPKESAVPNDVISYAKSLPGISQPFPQLFDPFNLLGNAAGTKDGVNEVKRWRESEL 4 +D + P VP +V+ YAK +PG+ PFP +FDP +LL AA + + E+ RWRESE+ Sbjct: 38 ADKVSPDPEVVPPNVLEYAKGMPGVCAPFPNIFDPADLLARAASSPRPIKELNRWRESEI 97 Query: 3 T 1 T Sbjct: 98 T 98 >ref|XP_001768071.1| predicted protein [Physcomitrella patens] gi|162680709|gb|EDQ67143.1| predicted protein [Physcomitrella patens] Length = 244 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/61 (44%), Positives = 42/61 (68%) Frame = -1 Query: 183 SDPIPPKESAVPNDVISYAKSLPGISQPFPQLFDPFNLLGNAAGTKDGVNEVKRWRESEL 4 +D + P + VP +V+ YAK++PG++ PF +FDP +LL AA + + E+ RWRESE+ Sbjct: 38 ADKVSPDPAVVPPNVLEYAKTMPGVTAPFENIFDPADLLARAASSPRPIKELNRWRESEI 97 Query: 3 T 1 T Sbjct: 98 T 98 >ref|XP_001696125.1| stress-related chlorophyll a/b binding protein 1 [Chlamydomonas reinhardtii] gi|1865773|emb|CAA64632.1| LI818r-1 [Chlamydomonas reinhardtii] gi|158275296|gb|EDP01074.1| stress-related chlorophyll a/b binding protein 1 [Chlamydomonas reinhardtii] Length = 253 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/51 (50%), Positives = 36/51 (70%) Frame = -1 Query: 153 VPNDVISYAKSLPGISQPFPQLFDPFNLLGNAAGTKDGVNEVKRWRESELT 1 VP DV++YAK+LPG++ PF +FDP L A+ V +V+RWRESE+T Sbjct: 38 VPEDVLAYAKTLPGVTAPFDNVFDPAGFLATAS-----VKDVRRWRESEIT 83