BLASTX nr result
ID: Ziziphus21_contig00011445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00011445 (662 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007203355.1| hypothetical protein PRUPE_ppa020478mg [Prun... 107 5e-21 ref|XP_008242424.1| PREDICTED: pentatricopeptide repeat-containi... 106 1e-20 ref|XP_009352615.1| PREDICTED: pentatricopeptide repeat-containi... 103 9e-20 ref|XP_008352364.1| PREDICTED: pentatricopeptide repeat-containi... 101 3e-19 ref|XP_008337673.1| PREDICTED: pentatricopeptide repeat-containi... 101 3e-19 ref|XP_004288922.1| PREDICTED: putative pentatricopeptide repeat... 101 5e-19 ref|XP_008451345.1| PREDICTED: pentatricopeptide repeat-containi... 95 3e-17 ref|XP_008451344.1| PREDICTED: pentatricopeptide repeat-containi... 95 3e-17 ref|XP_008451343.1| PREDICTED: pentatricopeptide repeat-containi... 95 3e-17 ref|XP_008451342.1| PREDICTED: pentatricopeptide repeat-containi... 95 3e-17 ref|XP_008451337.1| PREDICTED: pentatricopeptide repeat-containi... 95 3e-17 ref|XP_008451336.1| PREDICTED: pentatricopeptide repeat-containi... 95 3e-17 ref|XP_011011864.1| PREDICTED: putative pentatricopeptide repeat... 94 6e-17 emb|CBI27939.3| unnamed protein product [Vitis vinifera] 94 6e-17 ref|XP_003633097.1| PREDICTED: pentatricopeptide repeat-containi... 94 6e-17 gb|KGN44805.1| hypothetical protein Csa_7G388380 [Cucumis sativus] 94 9e-17 ref|XP_006371982.1| hypothetical protein POPTR_0018s06910g [Popu... 94 9e-17 ref|XP_004147002.1| PREDICTED: pentatricopeptide repeat-containi... 94 9e-17 ref|XP_012455782.1| PREDICTED: pentatricopeptide repeat-containi... 91 6e-16 gb|KJB07716.1| hypothetical protein B456_001G040600 [Gossypium r... 91 6e-16 >ref|XP_007203355.1| hypothetical protein PRUPE_ppa020478mg [Prunus persica] gi|462398886|gb|EMJ04554.1| hypothetical protein PRUPE_ppa020478mg [Prunus persica] Length = 872 Score = 107 bits (268), Expect = 5e-21 Identities = 46/57 (80%), Positives = 54/57 (94%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 ST+P KTIRIFKNLRICG+CH+VMKLIS++ NREI+VRDIK FHHFK+GTCSC+DFW Sbjct: 816 STNPPKTIRIFKNLRICGDCHEVMKLISDVTNREIVVRDIKRFHHFKSGTCSCNDFW 872 >ref|XP_008242424.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Prunus mume] Length = 872 Score = 106 bits (264), Expect = 1e-20 Identities = 44/57 (77%), Positives = 53/57 (92%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 ST+P KTIRIFKN+RICG+CH+VMKLIS + NREI+VRD+K FHHFK+GTCSC+DFW Sbjct: 816 STNPPKTIRIFKNIRICGDCHEVMKLISEVTNREIVVRDVKRFHHFKSGTCSCNDFW 872 >ref|XP_009352615.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Pyrus x bretschneideri] gi|694323057|ref|XP_009352616.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Pyrus x bretschneideri] Length = 985 Score = 103 bits (257), Expect = 9e-20 Identities = 45/57 (78%), Positives = 51/57 (89%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS KTIRIFKNLRICG+CHDVMKL+S++ NREI+VRDI+ FHHFK GTCSC DFW Sbjct: 929 STSHPKTIRIFKNLRICGDCHDVMKLVSDVTNREIVVRDIRRFHHFKNGTCSCKDFW 985 >ref|XP_008352364.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Malus domestica] Length = 877 Score = 101 bits (252), Expect = 3e-19 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS KTIRIFKNLRICG+CHD MKL+S++ NREI+VRDI+ FHHFK GTCSC DFW Sbjct: 821 STSHPKTIRIFKNLRICGDCHDXMKLVSDVTNREIVVRDIRRFHHFKNGTCSCKDFW 877 >ref|XP_008337673.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Malus domestica] gi|658005081|ref|XP_008337674.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Malus domestica] Length = 987 Score = 101 bits (252), Expect = 3e-19 Identities = 44/57 (77%), Positives = 50/57 (87%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS KTIRIFKNLRICG+CHD MKL+S++ NREI+VRDI+ FHHFK GTCSC DFW Sbjct: 931 STSHPKTIRIFKNLRICGDCHDXMKLVSDVTNREIVVRDIRRFHHFKNGTCSCKDFW 987 >ref|XP_004288922.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Fragaria vesca subsp. vesca] gi|764509415|ref|XP_011459736.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Fragaria vesca subsp. vesca] gi|764509420|ref|XP_011459740.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Fragaria vesca subsp. vesca] Length = 984 Score = 101 bits (251), Expect = 5e-19 Identities = 46/57 (80%), Positives = 49/57 (85%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 ST P+KTI IFKNLRICG+CHDVMKLIS+I NREIIVRDIK FH FK GTCSC D W Sbjct: 928 STDPVKTIHIFKNLRICGDCHDVMKLISDITNREIIVRDIKRFHDFKNGTCSCQDSW 984 >ref|XP_008451345.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X6 [Cucumis melo] Length = 786 Score = 95.1 bits (235), Expect = 3e-17 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS K IRIFKNLRICG+CHDVMK IS+I ++EI+VRD++ FHHFK G CSC+DFW Sbjct: 730 STSSKKKIRIFKNLRICGDCHDVMKHISSITHQEIVVRDVRRFHHFKNGACSCNDFW 786 >ref|XP_008451344.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X5 [Cucumis melo] Length = 851 Score = 95.1 bits (235), Expect = 3e-17 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS K IRIFKNLRICG+CHDVMK IS+I ++EI+VRD++ FHHFK G CSC+DFW Sbjct: 795 STSSKKKIRIFKNLRICGDCHDVMKHISSITHQEIVVRDVRRFHHFKNGACSCNDFW 851 >ref|XP_008451343.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X4 [Cucumis melo] Length = 872 Score = 95.1 bits (235), Expect = 3e-17 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS K IRIFKNLRICG+CHDVMK IS+I ++EI+VRD++ FHHFK G CSC+DFW Sbjct: 816 STSSKKKIRIFKNLRICGDCHDVMKHISSITHQEIVVRDVRRFHHFKNGACSCNDFW 872 >ref|XP_008451342.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X3 [Cucumis melo] Length = 971 Score = 95.1 bits (235), Expect = 3e-17 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS K IRIFKNLRICG+CHDVMK IS+I ++EI+VRD++ FHHFK G CSC+DFW Sbjct: 915 STSSKKKIRIFKNLRICGDCHDVMKHISSITHQEIVVRDVRRFHHFKNGACSCNDFW 971 >ref|XP_008451337.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X2 [Cucumis melo] gi|659100926|ref|XP_008451339.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X2 [Cucumis melo] gi|659100928|ref|XP_008451340.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X2 [Cucumis melo] gi|659100930|ref|XP_008451341.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X2 [Cucumis melo] Length = 989 Score = 95.1 bits (235), Expect = 3e-17 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS K IRIFKNLRICG+CHDVMK IS+I ++EI+VRD++ FHHFK G CSC+DFW Sbjct: 933 STSSKKKIRIFKNLRICGDCHDVMKHISSITHQEIVVRDVRRFHHFKNGACSCNDFW 989 >ref|XP_008451336.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like isoform X1 [Cucumis melo] Length = 1000 Score = 95.1 bits (235), Expect = 3e-17 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS K IRIFKNLRICG+CHDVMK IS+I ++EI+VRD++ FHHFK G CSC+DFW Sbjct: 944 STSSKKKIRIFKNLRICGDCHDVMKHISSITHQEIVVRDVRRFHHFKNGACSCNDFW 1000 >ref|XP_011011864.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Populus euphratica] Length = 995 Score = 94.4 bits (233), Expect = 6e-17 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 ST+ +K IRIFKNLRIC +CHD MKLIS+I N+EI+VRDIK FHHFK GTCSC D W Sbjct: 939 STNAVKPIRIFKNLRICEDCHDFMKLISDITNQEILVRDIKRFHHFKRGTCSCQDRW 995 >emb|CBI27939.3| unnamed protein product [Vitis vinifera] Length = 764 Score = 94.4 bits (233), Expect = 6e-17 Identities = 41/57 (71%), Positives = 47/57 (82%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS KTIRIFKNLRICG+CHD MK IS I N+E++VRDI FHHFK G+CSC +FW Sbjct: 708 STSTRKTIRIFKNLRICGDCHDFMKSISEITNQELVVRDINCFHHFKNGSCSCQNFW 764 >ref|XP_003633097.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Vitis vinifera] gi|731406609|ref|XP_010656220.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Vitis vinifera] gi|731406611|ref|XP_010656221.1| PREDICTED: pentatricopeptide repeat-containing protein At3g24000, mitochondrial-like [Vitis vinifera] Length = 1005 Score = 94.4 bits (233), Expect = 6e-17 Identities = 41/57 (71%), Positives = 47/57 (82%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS KTIRIFKNLRICG+CHD MK IS I N+E++VRDI FHHFK G+CSC +FW Sbjct: 949 STSTRKTIRIFKNLRICGDCHDFMKSISEITNQELVVRDINCFHHFKNGSCSCQNFW 1005 >gb|KGN44805.1| hypothetical protein Csa_7G388380 [Cucumis sativus] Length = 1094 Score = 93.6 bits (231), Expect = 9e-17 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS K IRIFKNLRIC +CHDVMK IS+I N+EI+VRD++ FHHFK G CSC+DFW Sbjct: 1038 STSSEKKIRIFKNLRICRDCHDVMKHISSITNQEIVVRDVRRFHHFKNGACSCNDFW 1094 >ref|XP_006371982.1| hypothetical protein POPTR_0018s06910g [Populus trichocarpa] gi|550318228|gb|ERP49779.1| hypothetical protein POPTR_0018s06910g [Populus trichocarpa] Length = 872 Score = 93.6 bits (231), Expect = 9e-17 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 ST+ +K IRIFKNLRIC +CHD MKLIS+I N+EI+VRDI+ FHHFK GTCSC D W Sbjct: 816 STNAVKPIRIFKNLRICEDCHDFMKLISDITNQEIVVRDIRRFHHFKRGTCSCQDRW 872 >ref|XP_004147002.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Cucumis sativus] gi|778727671|ref|XP_011659297.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Cucumis sativus] gi|778727676|ref|XP_011659298.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Cucumis sativus] gi|778727680|ref|XP_011659299.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03880, mitochondrial-like [Cucumis sativus] Length = 989 Score = 93.6 bits (231), Expect = 9e-17 Identities = 41/57 (71%), Positives = 48/57 (84%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 STS K IRIFKNLRIC +CHDVMK IS+I N+EI+VRD++ FHHFK G CSC+DFW Sbjct: 933 STSSEKKIRIFKNLRICRDCHDVMKHISSITNQEIVVRDVRRFHHFKNGACSCNDFW 989 >ref|XP_012455782.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070 [Gossypium raimondii] Length = 736 Score = 90.9 bits (224), Expect = 6e-16 Identities = 40/57 (70%), Positives = 43/57 (75%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 ST P TIRI KNLR+CGNCH KLIS I NREII RD FHHFK G+CSC+DFW Sbjct: 680 STKPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGSCSCNDFW 736 >gb|KJB07716.1| hypothetical protein B456_001G040600 [Gossypium raimondii] Length = 709 Score = 90.9 bits (224), Expect = 6e-16 Identities = 40/57 (70%), Positives = 43/57 (75%) Frame = +1 Query: 1 STSPLKTIRIFKNLRICGNCHDVMKLISNIMNREIIVRDIKMFHHFKAGTCSCHDFW 171 ST P TIRI KNLR+CGNCH KLIS I NREII RD FHHFK G+CSC+DFW Sbjct: 653 STKPGTTIRIVKNLRVCGNCHSATKLISKIFNREIIARDRNRFHHFKDGSCSCNDFW 709