BLASTX nr result
ID: Ziziphus21_contig00011379
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00011379 (411 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002523672.1| Alpha-N-arabinofuranosidase 1 precursor, put... 56 9e-06 >ref|XP_002523672.1| Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis] gi|223537072|gb|EEF38707.1| Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis] Length = 678 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = -1 Query: 408 SPLENAAAKMDVVLPPHSLTSFDLLKGPSYIRITGADSFSRSSI 277 S L++A MDVVLPP+SLTS+DLL S I+ITG DS SRSSI Sbjct: 635 SMLDHAGKDMDVVLPPYSLTSYDLLTESSNIKITGTDSLSRSSI 678