BLASTX nr result
ID: Ziziphus21_contig00011308
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00011308 (314 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154290.1| PREDICTED: mitochondrial import receptor sub... 97 4e-18 ref|XP_014493496.1| PREDICTED: mitochondrial import receptor sub... 96 8e-18 ref|XP_012069348.1| PREDICTED: mitochondrial import receptor sub... 96 8e-18 ref|XP_012458102.1| PREDICTED: mitochondrial import receptor sub... 96 1e-17 ref|XP_012458101.1| PREDICTED: mitochondrial import receptor sub... 96 1e-17 ref|XP_002519115.1| conserved hypothetical protein [Ricinus comm... 96 1e-17 ref|XP_007019163.1| Translocase of the outer mitochondrial membr... 95 2e-17 ref|XP_010096240.1| hypothetical protein L484_026977 [Morus nota... 95 2e-17 ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 f... 94 5e-17 gb|KHF97675.1| Mitochondrial import receptor subunit TOM6 -like ... 93 7e-17 ref|XP_012474303.1| PREDICTED: mitochondrial import receptor sub... 93 9e-17 ref|XP_009596562.1| PREDICTED: mitochondrial import receptor sub... 93 9e-17 ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citr... 93 9e-17 ref|XP_004230848.1| PREDICTED: mitochondrial import receptor sub... 93 9e-17 gb|KHG18108.1| Mitochondrial import receptor subunit TOM6 -like ... 92 2e-16 ref|XP_006590915.1| PREDICTED: mitochondrial import receptor sub... 92 2e-16 gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlise... 92 2e-16 ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phas... 91 3e-16 ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Popu... 91 3e-16 ref|XP_009798301.1| PREDICTED: mitochondrial import receptor sub... 91 3e-16 >ref|XP_004154290.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|659118678|ref|XP_008459247.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis melo] gi|659118680|ref|XP_008459248.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis melo] gi|778669220|ref|XP_011649217.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Cucumis sativus] gi|700206642|gb|KGN61761.1| hypothetical protein Csa_2G238770 [Cucumis sativus] Length = 54 Score = 97.4 bits (241), Expect = 4e-18 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 77 MFPGMF+RKPDK AALKQLR+HVA+FG WVAVIRVTPYVLHYL EKEEL+L+F Sbjct: 1 MFPGMFMRKPDKAAALKQLRSHVAMFGVWVAVIRVTPYVLHYLSDEKEELKLDF 54 >ref|XP_014493496.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Vigna radiata var. radiata] gi|920708858|gb|KOM50855.1| hypothetical protein LR48_Vigan08g168200 [Vigna angularis] Length = 54 Score = 96.3 bits (238), Expect = 8e-18 Identities = 44/53 (83%), Positives = 50/53 (94%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLE 80 MFPGMF+RKPDK AALKQL++HVA+FGAWV VIRVTPYVLH+L GEKEEL+LE Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVAMFGAWVVVIRVTPYVLHFLSGEKEELKLE 53 >ref|XP_012069348.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Jatropha curcas] gi|643740610|gb|KDP46200.1| hypothetical protein JCGZ_10040 [Jatropha curcas] Length = 54 Score = 96.3 bits (238), Expect = 8e-18 Identities = 43/54 (79%), Positives = 49/54 (90%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 77 MFPGMF+RKPDK AALKQL+THVA+FG WVAV+RV PY+LHYL EK+ELRLEF Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVAMFGVWVAVVRVAPYILHYLSDEKDELRLEF 54 >ref|XP_012458102.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] gi|823251026|ref|XP_012458103.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] gi|763810991|gb|KJB77893.1| hypothetical protein B456_012G163900 [Gossypium raimondii] Length = 54 Score = 95.5 bits (236), Expect = 1e-17 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 77 MFPGMF+RKPDK AALKQL+ HVA+FG WVAV+RVTPY+LHYL EKEEL++EF Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLSDEKEELKIEF 54 >ref|XP_012458101.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] gi|763810990|gb|KJB77892.1| hypothetical protein B456_012G163800 [Gossypium raimondii] Length = 54 Score = 95.5 bits (236), Expect = 1e-17 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 77 MFPGMF+RKPDK AALKQL+ HVA+FG WVAV+RVTPY+LHYL EKEEL++EF Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHYLSDEKEELKIEF 54 >ref|XP_002519115.1| conserved hypothetical protein [Ricinus communis] gi|223541778|gb|EEF43326.1| conserved hypothetical protein [Ricinus communis] Length = 54 Score = 95.5 bits (236), Expect = 1e-17 Identities = 43/54 (79%), Positives = 50/54 (92%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 77 MFPGMF+RKPDK AALKQL+TH AIFGAWVA+IRVTPYVLHYL +K+EL+L+F Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHAAIFGAWVALIRVTPYVLHYLSDDKDELKLDF 54 >ref|XP_007019163.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] gi|508724491|gb|EOY16388.1| Translocase of the outer mitochondrial membrane 6 [Theobroma cacao] Length = 54 Score = 95.1 bits (235), Expect = 2e-17 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 77 MFPGMF+RKPDK AALKQL+ HVA+FG WVAV+RVTPY+LHYL +KEEL+LEF Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLSDDKEELKLEF 54 >ref|XP_010096240.1| hypothetical protein L484_026977 [Morus notabilis] gi|587874497|gb|EXB63635.1| hypothetical protein L484_026977 [Morus notabilis] Length = 54 Score = 94.7 bits (234), Expect = 2e-17 Identities = 43/53 (81%), Positives = 49/53 (92%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLE 80 MFPGMF+RKPDK AALKQLRTHVA+FGAWVAVIRVTPY+LHY+ E +EL+LE Sbjct: 1 MFPGMFMRKPDKAAALKQLRTHVAMFGAWVAVIRVTPYILHYISRESDELKLE 53 >ref|XP_002305407.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] gi|118484423|gb|ABK94088.1| unknown [Populus trichocarpa] gi|222848371|gb|EEE85918.1| Mitochondrial import receptor subunit TOM6 family protein [Populus trichocarpa] Length = 54 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 77 MFPGMF+RKPDK ALKQL++HVA+FGAWV V+RVTPYVLHYL EK+EL+LEF Sbjct: 1 MFPGMFMRKPDKAEALKQLKSHVAMFGAWVVVLRVTPYVLHYLSDEKDELKLEF 54 >gb|KHF97675.1| Mitochondrial import receptor subunit TOM6 -like protein [Gossypium arboreum] Length = 93 Score = 93.2 bits (230), Expect = 7e-17 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLE 80 MFPGMF+RKPDK AALKQL+ HVA+FG WVAV+RVTPY+LHYL EKEEL++E Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVRVTPYILHYLSDEKEELKIE 53 >ref|XP_012474303.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Gossypium raimondii] gi|763756224|gb|KJB23555.1| hypothetical protein B456_004G104500 [Gossypium raimondii] Length = 54 Score = 92.8 bits (229), Expect = 9e-17 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 77 MFPGMF+RKPDK AALKQL+ HVA+FG WVAV+ VTPY+LHYL EKEEL++EF Sbjct: 1 MFPGMFMRKPDKAAALKQLKAHVAMFGVWVAVVLVTPYILHYLSDEKEELKIEF 54 >ref|XP_009596562.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana tomentosiformis] gi|698489778|ref|XP_009791420.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana sylvestris] Length = 54 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLE 80 MFPG+F+RKPDK AALKQL+THVA+FGAWVAVIRVTPY+LHY +KEEL LE Sbjct: 1 MFPGLFMRKPDKAAALKQLKTHVALFGAWVAVIRVTPYILHYFSDQKEELLLE 53 >ref|XP_006423157.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|567861008|ref|XP_006423158.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|568851345|ref|XP_006479354.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X1 [Citrus sinensis] gi|568851347|ref|XP_006479355.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog isoform X2 [Citrus sinensis] gi|557525091|gb|ESR36397.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] gi|557525092|gb|ESR36398.1| hypothetical protein CICLE_v10029767mg [Citrus clementina] Length = 54 Score = 92.8 bits (229), Expect = 9e-17 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 77 MFPGMF++KPDK AALKQLR+HVA+FG WV VIRVTPY+LHY EKEEL+LEF Sbjct: 1 MFPGMFMKKPDKAAALKQLRSHVAMFGTWVVVIRVTPYLLHYFSREKEELKLEF 54 >ref|XP_004230848.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum lycopersicum] gi|565399930|ref|XP_006365492.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Solanum tuberosum] Length = 54 Score = 92.8 bits (229), Expect = 9e-17 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 77 MFPGMF+RKPDK AALKQL+THV +FG WVAVIRV PY+LHY +KEEL+LEF Sbjct: 1 MFPGMFMRKPDKAAALKQLKTHVVLFGTWVAVIRVAPYILHYFSDQKEELKLEF 54 >gb|KHG18108.1| Mitochondrial import receptor subunit TOM6 -like protein [Gossypium arboreum] Length = 76 Score = 92.0 bits (227), Expect = 2e-16 Identities = 40/53 (75%), Positives = 48/53 (90%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLE 80 MFPGMF+RKPDK AALKQL+ HVA+FG WVAV+RVTPY+LHYL EKEEL+++ Sbjct: 1 MFPGMFMRKPDKAAALKQLKVHVAMFGVWVAVVRVTPYILHYLSDEKEELKID 53 >ref|XP_006590915.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Glycine max] gi|734329252|gb|KHN06159.1| Mitochondrial import receptor subunit TOM6 like [Glycine soja] gi|947080746|gb|KRH29535.1| hypothetical protein GLYMA_11G122300 [Glycine max] gi|947080747|gb|KRH29536.1| hypothetical protein GLYMA_11G122300 [Glycine max] Length = 54 Score = 91.7 bits (226), Expect = 2e-16 Identities = 42/53 (79%), Positives = 48/53 (90%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLE 80 MFPGMF+RKPDK AALKQL++H A+FGAWV VIRVTPYVLH+L EKEEL+LE Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHAAMFGAWVVVIRVTPYVLHFLSTEKEELKLE 53 >gb|EPS68378.1| hypothetical protein M569_06396, partial [Genlisea aurea] Length = 54 Score = 91.7 bits (226), Expect = 2e-16 Identities = 40/53 (75%), Positives = 47/53 (88%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLE 80 MFPGMF+RKPDK AALKQL++H +FGAW+AV+R PYVLHYL GEKEEL+LE Sbjct: 2 MFPGMFMRKPDKAAALKQLKSHAIMFGAWIAVVRAAPYVLHYLSGEKEELKLE 54 >ref|XP_007131882.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] gi|561004882|gb|ESW03876.1| hypothetical protein PHAVU_011G049200g [Phaseolus vulgaris] Length = 54 Score = 91.3 bits (225), Expect = 3e-16 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLE 80 MFPGMF+RKPDK AALKQL++HV +FGAWV VIRVTPYVLH+L EKEEL+L+ Sbjct: 1 MFPGMFMRKPDKAAALKQLKSHVTMFGAWVVVIRVTPYVLHFLTAEKEELKLQ 53 >ref|XP_002313822.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] gi|118483621|gb|ABK93705.1| unknown [Populus trichocarpa] gi|222850230|gb|EEE87777.1| hypothetical protein POPTR_0009s11330g [Populus trichocarpa] Length = 54 Score = 91.3 bits (225), Expect = 3e-16 Identities = 40/54 (74%), Positives = 49/54 (90%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLEF 77 MFPG+F++KPDK ALKQLR+HVA+FGAWV V+RVTPYVLHY+ EK+EL+LEF Sbjct: 1 MFPGLFMKKPDKAEALKQLRSHVAMFGAWVVVLRVTPYVLHYISHEKDELKLEF 54 >ref|XP_009798301.1| PREDICTED: mitochondrial import receptor subunit TOM6 homolog [Nicotiana sylvestris] Length = 54 Score = 90.9 bits (224), Expect = 3e-16 Identities = 41/53 (77%), Positives = 46/53 (86%) Frame = -2 Query: 238 MFPGMFIRKPDKEAALKQLRTHVAIFGAWVAVIRVTPYVLHYLYGEKEELRLE 80 MFPG+F+RKPDK AALKQL+THVA+FG WVAVIRVTPY+LHY KEEL LE Sbjct: 1 MFPGLFMRKPDKAAALKQLKTHVALFGTWVAVIRVTPYILHYFSDSKEELMLE 53