BLASTX nr result
ID: Ziziphus21_contig00011170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00011170 (331 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009343156.1| PREDICTED: protein kinase APK1B, chloroplast... 73 7e-11 ref|XP_008222233.1| PREDICTED: putative receptor-like protein ki... 73 1e-10 ref|XP_008389886.1| PREDICTED: protein kinase APK1B, chloroplast... 72 2e-10 ref|XP_010090634.1| Serine/threonine-protein kinase BIK1 [Morus ... 69 1e-09 ref|XP_004310220.1| PREDICTED: protein kinase APK1B, chloroplast... 63 1e-07 >ref|XP_009343156.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Pyrus x bretschneideri] Length = 332 Score = 73.2 bits (178), Expect = 7e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +3 Query: 3 NRHPNLVKLIGYCCEKEVRGVVYDLNPKDTLYNLTLAGFLN 125 N HPNLVKLIGYCCEKEV+GVVYDLNP DTL+NLT +LN Sbjct: 87 NGHPNLVKLIGYCCEKEVKGVVYDLNPWDTLHNLTDKDYLN 127 >ref|XP_008222233.1| PREDICTED: putative receptor-like protein kinase At1g72540 [Prunus mume] Length = 342 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 3 NRHPNLVKLIGYCCEKEVRGVVYDLNPKDTLYNLTLAGFLN 125 N HPNLVKLIGYCCEKEV+ VVYDLNP DTL+NLT+ +LN Sbjct: 90 NGHPNLVKLIGYCCEKEVKAVVYDLNPWDTLHNLTVKDYLN 130 >ref|XP_008389886.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Malus domestica] Length = 335 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +3 Query: 3 NRHPNLVKLIGYCCEKEVRGVVYDLNPKDTLYNLTLAGFLN 125 N +PNLVKLIGYCCEKEV+GVVYDLNP DTL NLT+ +LN Sbjct: 90 NDYPNLVKLIGYCCEKEVKGVVYDLNPWDTLQNLTVKDYLN 130 >ref|XP_010090634.1| Serine/threonine-protein kinase BIK1 [Morus notabilis] gi|587850109|gb|EXB40298.1| Serine/threonine-protein kinase BIK1 [Morus notabilis] Length = 334 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 3 NRHPNLVKLIGYCCEKEVRGVVYDLNPKDTLYNLTLAGFLN 125 N HPNLVK+IG CC+KEVRGVVYDLNP+DTL+NL L LN Sbjct: 82 NGHPNLVKVIGVCCDKEVRGVVYDLNPRDTLHNLILKDELN 122 >ref|XP_004310220.1| PREDICTED: protein kinase APK1B, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 336 Score = 62.8 bits (151), Expect = 1e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +3 Query: 9 HPNLVKLIGYCCEKEVRGVVYDLNPKDTLYNL 104 HPNLV LIGYCCEKEV+GV+YDL+P DTL+NL Sbjct: 92 HPNLVNLIGYCCEKEVKGVIYDLSPWDTLHNL 123