BLASTX nr result
ID: Ziziphus21_contig00011151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00011151 (267 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208336.1| hypothetical protein PRUPE_ppa002184mg [Prun... 87 6e-15 ref|XP_008238495.1| PREDICTED: U-box domain-containing protein 4... 85 2e-14 ref|XP_010087281.1| U-box domain-containing protein 4 [Morus not... 80 8e-13 ref|XP_004287978.1| PREDICTED: U-box domain-containing protein 4... 78 2e-12 ref|XP_007047436.1| RING/U-box superfamily protein with ARM repe... 74 4e-11 ref|XP_006466517.1| PREDICTED: U-box domain-containing protein 4... 74 6e-11 ref|XP_011463613.1| PREDICTED: U-box domain-containing protein 4... 73 1e-10 ref|XP_012437086.1| PREDICTED: U-box domain-containing protein 4... 72 2e-10 ref|XP_009367873.1| PREDICTED: U-box domain-containing protein 4... 72 2e-10 ref|XP_009367853.1| PREDICTED: U-box domain-containing protein 4... 72 2e-10 ref|XP_012461158.1| PREDICTED: U-box domain-containing protein 2... 72 2e-10 ref|XP_012437088.1| PREDICTED: U-box domain-containing protein 4... 72 2e-10 gb|KJB43859.1| hypothetical protein B456_007G219900 [Gossypium r... 72 2e-10 ref|XP_012491914.1| PREDICTED: U-box domain-containing protein 4... 72 2e-10 gb|KHG09481.1| U-box domain-containing 4 -like protein [Gossypiu... 72 2e-10 ref|XP_009336069.1| PREDICTED: U-box domain-containing protein 4... 71 3e-10 ref|XP_006466521.1| PREDICTED: U-box domain-containing protein 4... 70 6e-10 gb|KCW54797.1| hypothetical protein EUGRSUZ_I00736 [Eucalyptus g... 69 1e-09 ref|XP_010028138.1| PREDICTED: U-box domain-containing protein 4... 69 1e-09 gb|KCW54795.1| hypothetical protein EUGRSUZ_I00736 [Eucalyptus g... 69 1e-09 >ref|XP_007208336.1| hypothetical protein PRUPE_ppa002184mg [Prunus persica] gi|462403978|gb|EMJ09535.1| hypothetical protein PRUPE_ppa002184mg [Prunus persica] Length = 704 Score = 86.7 bits (213), Expect = 6e-15 Identities = 43/55 (78%), Positives = 48/55 (87%) Frame = -1 Query: 165 LVKKGVMEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 +V KGVMEISL KALLKNISSF HLSS DNINL+PV KYY+R EEILKLL T+L+ Sbjct: 1 MVNKGVMEISLFKALLKNISSFFHLSSNDNINLDPVLKYYKRAEEILKLLKTILD 55 >ref|XP_008238495.1| PREDICTED: U-box domain-containing protein 4 [Prunus mume] Length = 844 Score = 85.1 bits (209), Expect = 2e-14 Identities = 43/55 (78%), Positives = 47/55 (85%) Frame = -1 Query: 165 LVKKGVMEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 +V KGVMEISL KALL NISSF HLSS DNINL+PV KYY+R EEILKLL TVL+ Sbjct: 1 MVNKGVMEISLFKALLNNISSFFHLSSNDNINLDPVLKYYKRAEEILKLLKTVLD 55 >ref|XP_010087281.1| U-box domain-containing protein 4 [Morus notabilis] gi|587838001|gb|EXB28728.1| U-box domain-containing protein 4 [Morus notabilis] Length = 900 Score = 79.7 bits (195), Expect = 8e-13 Identities = 40/51 (78%), Positives = 42/51 (82%) Frame = -1 Query: 153 GVMEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 GVMEISLLK LL NISSF HLSSC NIN EP KYYQR EEILKLL T+L+ Sbjct: 21 GVMEISLLKVLLDNISSFFHLSSCVNINSEPFLKYYQRAEEILKLLKTILD 71 >ref|XP_004287978.1| PREDICTED: U-box domain-containing protein 4 isoform X1 [Fragaria vesca subsp. vesca] Length = 839 Score = 78.2 bits (191), Expect = 2e-12 Identities = 38/55 (69%), Positives = 46/55 (83%) Frame = -1 Query: 165 LVKKGVMEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 +V KG MEIS+LKALL +ISSF H SS +NIN++PV KYYQ+ EEILKLL TVL+ Sbjct: 1 MVNKGGMEISMLKALLNSISSFFHFSSHENINVDPVQKYYQKAEEILKLLKTVLD 55 >ref|XP_007047436.1| RING/U-box superfamily protein with ARM repeat domain isoform 1 [Theobroma cacao] gi|590705435|ref|XP_007047437.1| ATP synthase alpha/beta family protein isoform 1 [Theobroma cacao] gi|590705438|ref|XP_007047438.1| RING/U-box superfamily protein with ARM repeat domain isoform 1 [Theobroma cacao] gi|590705442|ref|XP_007047439.1| RING/U-box superfamily protein with ARM repeat domain isoform 1 [Theobroma cacao] gi|508699697|gb|EOX91593.1| RING/U-box superfamily protein with ARM repeat domain isoform 1 [Theobroma cacao] gi|508699698|gb|EOX91594.1| ATP synthase alpha/beta family protein isoform 1 [Theobroma cacao] gi|508699699|gb|EOX91595.1| RING/U-box superfamily protein with ARM repeat domain isoform 1 [Theobroma cacao] gi|508699700|gb|EOX91596.1| RING/U-box superfamily protein with ARM repeat domain isoform 1 [Theobroma cacao] Length = 834 Score = 73.9 bits (180), Expect = 4e-11 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVL 4 MEISLLKALL NISSFL+LSS +NIN EPV KYYQR EE+LKLL +L Sbjct: 1 MEISLLKALLSNISSFLNLSSSENINSEPVQKYYQRAEEVLKLLKPIL 48 >ref|XP_006466517.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Citrus sinensis] gi|568824256|ref|XP_006466518.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 [Citrus sinensis] gi|568824258|ref|XP_006466519.1| PREDICTED: U-box domain-containing protein 4-like isoform X3 [Citrus sinensis] gi|568824260|ref|XP_006466520.1| PREDICTED: U-box domain-containing protein 4-like isoform X4 [Citrus sinensis] Length = 834 Score = 73.6 bits (179), Expect = 6e-11 Identities = 38/55 (69%), Positives = 44/55 (80%) Frame = -1 Query: 165 LVKKGVMEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 +V +G MEISLLK LLK ISSFLHLSS D+I L+ V KYYQR EEILKLL +L+ Sbjct: 1 MVTQGGMEISLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEEILKLLKPILD 55 >ref|XP_011463613.1| PREDICTED: U-box domain-containing protein 4 isoform X2 [Fragaria vesca subsp. vesca] Length = 833 Score = 72.8 bits (177), Expect = 1e-10 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 MEIS+LKALL +ISSF H SS +NIN++PV KYYQ+ EEILKLL TVL+ Sbjct: 1 MEISMLKALLNSISSFFHFSSHENINVDPVQKYYQKAEEILKLLKTVLD 49 >ref|XP_012437086.1| PREDICTED: U-box domain-containing protein 4 isoform X1 [Gossypium raimondii] gi|823206412|ref|XP_012437087.1| PREDICTED: U-box domain-containing protein 4 isoform X1 [Gossypium raimondii] gi|763781571|gb|KJB48642.1| hypothetical protein B456_008G079700 [Gossypium raimondii] gi|763781572|gb|KJB48643.1| hypothetical protein B456_008G079700 [Gossypium raimondii] gi|763781573|gb|KJB48644.1| hypothetical protein B456_008G079700 [Gossypium raimondii] Length = 835 Score = 72.0 bits (175), Expect = 2e-10 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -1 Query: 162 VKKGVMEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVL 4 +K MEISLLKALL NISSFL+LSS +NIN EPV K+YQR EEILKLL +L Sbjct: 1 MKHDHMEISLLKALLGNISSFLNLSSFENINSEPVQKFYQRAEEILKLLKPIL 53 >ref|XP_009367873.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 [Pyrus x bretschneideri] Length = 792 Score = 72.0 bits (175), Expect = 2e-10 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 MEISL KALL NISSF HLSS DNIN +PV KY +R EEILKLL TVL+ Sbjct: 1 MEISLFKALLNNISSFFHLSSHDNINFDPVLKYCKRAEEILKLLKTVLD 49 >ref|XP_009367853.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Pyrus x bretschneideri] gi|694313705|ref|XP_009367860.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Pyrus x bretschneideri] gi|694313707|ref|XP_009367866.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Pyrus x bretschneideri] Length = 831 Score = 72.0 bits (175), Expect = 2e-10 Identities = 37/49 (75%), Positives = 40/49 (81%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 MEISL KALL NISSF HLSS DNIN +PV KY +R EEILKLL TVL+ Sbjct: 1 MEISLFKALLNNISSFFHLSSHDNINFDPVLKYCKRAEEILKLLKTVLD 49 >ref|XP_012461158.1| PREDICTED: U-box domain-containing protein 2-like [Gossypium raimondii] Length = 122 Score = 71.6 bits (174), Expect = 2e-10 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVL 4 MEISLLKALL NISSFL+LSS +NIN EPV K+YQR EEILKLL +L Sbjct: 1 MEISLLKALLGNISSFLNLSSFENINSEPVQKFYQRAEEILKLLKPIL 48 >ref|XP_012437088.1| PREDICTED: U-box domain-containing protein 4 isoform X2 [Gossypium raimondii] gi|823206418|ref|XP_012437089.1| PREDICTED: U-box domain-containing protein 4 isoform X2 [Gossypium raimondii] Length = 830 Score = 71.6 bits (174), Expect = 2e-10 Identities = 37/48 (77%), Positives = 41/48 (85%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVL 4 MEISLLKALL NISSFL+LSS +NIN EPV K+YQR EEILKLL +L Sbjct: 1 MEISLLKALLGNISSFLNLSSFENINSEPVQKFYQRAEEILKLLKPIL 48 >gb|KJB43859.1| hypothetical protein B456_007G219900 [Gossypium raimondii] Length = 788 Score = 71.6 bits (174), Expect = 2e-10 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVL 4 MEISLLKALL NISSFL+LSS + IN EPV KYYQR EEILKLL +L Sbjct: 1 MEISLLKALLSNISSFLNLSSFEKINSEPVQKYYQRAEEILKLLKPIL 48 >ref|XP_012491914.1| PREDICTED: U-box domain-containing protein 4-like [Gossypium raimondii] gi|823192923|ref|XP_012491915.1| PREDICTED: U-box domain-containing protein 4-like [Gossypium raimondii] gi|763776735|gb|KJB43858.1| hypothetical protein B456_007G219900 [Gossypium raimondii] gi|763776737|gb|KJB43860.1| hypothetical protein B456_007G219900 [Gossypium raimondii] Length = 828 Score = 71.6 bits (174), Expect = 2e-10 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVL 4 MEISLLKALL NISSFL+LSS + IN EPV KYYQR EEILKLL +L Sbjct: 1 MEISLLKALLSNISSFLNLSSFEKINSEPVQKYYQRAEEILKLLKPIL 48 >gb|KHG09481.1| U-box domain-containing 4 -like protein [Gossypium arboreum] Length = 735 Score = 71.6 bits (174), Expect = 2e-10 Identities = 37/48 (77%), Positives = 40/48 (83%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVL 4 MEISLLKALL NISSFL+LSS + IN EPV KYYQR EEILKLL +L Sbjct: 1 MEISLLKALLSNISSFLNLSSFEKINSEPVQKYYQRAEEILKLLKPIL 48 >ref|XP_009336069.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri] gi|694415833|ref|XP_009336070.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri] gi|694415836|ref|XP_009336071.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri] gi|694415838|ref|XP_009336073.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri] gi|694415861|ref|XP_009336083.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri] gi|694415864|ref|XP_009336084.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri] gi|694415866|ref|XP_009336085.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri] gi|694415868|ref|XP_009336086.1| PREDICTED: U-box domain-containing protein 4-like [Pyrus x bretschneideri] Length = 836 Score = 71.2 bits (173), Expect = 3e-10 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 MEISL KALL NISSF HLSS +NIN +PV KYY+ EEILKLL TVL+ Sbjct: 1 MEISLFKALLNNISSFFHLSSHNNINFDPVLKYYKSAEEILKLLKTVLD 49 >ref|XP_006466521.1| PREDICTED: U-box domain-containing protein 4-like isoform X5 [Citrus sinensis] gi|568824264|ref|XP_006466522.1| PREDICTED: U-box domain-containing protein 4-like isoform X6 [Citrus sinensis] Length = 828 Score = 70.1 bits (170), Expect = 6e-10 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 MEISLLK LLK ISSFLHLSS D+I L+ V KYYQR EEILKLL +L+ Sbjct: 1 MEISLLKVLLKKISSFLHLSSFDSIKLDIVKKYYQRAEEILKLLKPILD 49 >gb|KCW54797.1| hypothetical protein EUGRSUZ_I00736 [Eucalyptus grandis] Length = 816 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 MEISLLKALL NIS + HLSS D+INLEP KYY++ EEILKL+ +L+ Sbjct: 1 MEISLLKALLSNISLYFHLSSSDSINLEPAQKYYKKAEEILKLVKPILD 49 >ref|XP_010028138.1| PREDICTED: U-box domain-containing protein 4 [Eucalyptus grandis] gi|702461160|ref|XP_010028139.1| PREDICTED: U-box domain-containing protein 4 [Eucalyptus grandis] gi|702461163|ref|XP_010028140.1| PREDICTED: U-box domain-containing protein 4 [Eucalyptus grandis] gi|702461169|ref|XP_010028141.1| PREDICTED: U-box domain-containing protein 4 [Eucalyptus grandis] gi|629088543|gb|KCW54796.1| hypothetical protein EUGRSUZ_I00736 [Eucalyptus grandis] Length = 831 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 MEISLLKALL NIS + HLSS D+INLEP KYY++ EEILKL+ +L+ Sbjct: 1 MEISLLKALLSNISLYFHLSSSDSINLEPAQKYYKKAEEILKLVKPILD 49 >gb|KCW54795.1| hypothetical protein EUGRSUZ_I00736 [Eucalyptus grandis] Length = 827 Score = 69.3 bits (168), Expect = 1e-09 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -1 Query: 147 MEISLLKALLKNISSFLHLSSCDNINLEPVSKYYQRTEEILKLLNTVLE 1 MEISLLKALL NIS + HLSS D+INLEP KYY++ EEILKL+ +L+ Sbjct: 1 MEISLLKALLSNISLYFHLSSSDSINLEPAQKYYKKAEEILKLVKPILD 49