BLASTX nr result
ID: Ziziphus21_contig00010166
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00010166 (342 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65859.1| hypothetical protein VITISV_014848 [Vitis vinife... 57 4e-06 >emb|CAN65859.1| hypothetical protein VITISV_014848 [Vitis vinifera] gi|297742394|emb|CBI34543.3| unnamed protein product [Vitis vinifera] Length = 86 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/71 (38%), Positives = 44/71 (61%) Frame = -2 Query: 314 MVSMIKVYAVILLLIFVSMSSGRVQGIRNGFYHRNTPNEVTVEKEMRNLISVEEVLDYPP 135 M S K +IL+L+F+ SSGRV+G + G + ++VT+ +MR ++ + +LDY Sbjct: 1 MGSQTKTVLLILILLFIPSSSGRVKGFKGGEGPATSVSKVTIIMDMREVLMTDALLDYGK 60 Query: 134 ARPNPRHGKGQ 102 PNPRH +G+ Sbjct: 61 PGPNPRHDQGK 71