BLASTX nr result
ID: Ziziphus21_contig00010147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00010147 (213 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010113211.1| BTB/POZ and MATH domain-containing protein 4... 100 7e-19 ref|XP_006479174.1| PREDICTED: BTB/POZ and MATH domain-containin... 92 1e-16 ref|XP_006479173.1| PREDICTED: BTB/POZ and MATH domain-containin... 92 1e-16 ref|XP_006443499.1| hypothetical protein CICLE_v10020215mg [Citr... 92 1e-16 gb|KDO66066.1| hypothetical protein CISIN_1g013880mg [Citrus sin... 91 3e-16 gb|KDO66065.1| hypothetical protein CISIN_1g013880mg [Citrus sin... 91 3e-16 gb|KDO66064.1| hypothetical protein CISIN_1g013880mg [Citrus sin... 91 3e-16 ref|XP_007202130.1| hypothetical protein PRUPE_ppa006091mg [Prun... 91 3e-16 ref|XP_007029996.1| BTB-POZ and MATH domain 4 isoform 2 [Theobro... 91 4e-16 ref|XP_007029995.1| BTB-POZ and MATH domain 4 isoform 1 [Theobro... 91 4e-16 ref|XP_012070393.1| PREDICTED: BTB/POZ and MATH domain-containin... 90 7e-16 ref|XP_012070390.1| PREDICTED: BTB/POZ and MATH domain-containin... 90 7e-16 ref|XP_008244139.1| PREDICTED: BTB/POZ and MATH domain-containin... 89 1e-15 gb|KOM38595.1| hypothetical protein LR48_Vigan03g197700 [Vigna a... 88 2e-15 ref|XP_012492474.1| PREDICTED: BTB/POZ and MATH domain-containin... 87 4e-15 gb|KJB44500.1| hypothetical protein B456_007G255900 [Gossypium r... 87 4e-15 gb|KJB44499.1| hypothetical protein B456_007G255900 [Gossypium r... 87 4e-15 ref|XP_012492473.1| PREDICTED: BTB/POZ and MATH domain-containin... 87 4e-15 gb|KHG25171.1| BTB/POZ and MATH domain-containing 4 -like protei... 87 4e-15 ref|XP_014491313.1| PREDICTED: BTB/POZ and MATH domain-containin... 87 6e-15 >ref|XP_010113211.1| BTB/POZ and MATH domain-containing protein 4 [Morus notabilis] gi|587989809|gb|EXC74092.1| BTB/POZ and MATH domain-containing protein 4 [Morus notabilis] Length = 359 Score = 99.8 bits (247), Expect = 7e-19 Identities = 51/58 (87%), Positives = 54/58 (93%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKE-FDGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNVSGVKF AHKLV+AARSSVFEKE FDG+EEDN EIVITDME DVFKALLH+IYRD Sbjct: 189 TFNVSGVKFPAHKLVMAARSSVFEKEIFDGIEEDNPEIVITDMEPDVFKALLHFIYRD 246 >ref|XP_006479174.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like isoform X3 [Citrus sinensis] Length = 359 Score = 92.4 bits (228), Expect = 1e-16 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV+G KFHAHKLVLAARS VFE EF D MEEDN EIV+TDME VFKALLH+IY+D Sbjct: 203 TFNVAGEKFHAHKLVLAARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKD 260 >ref|XP_006479173.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like isoform X2 [Citrus sinensis] Length = 434 Score = 92.4 bits (228), Expect = 1e-16 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV+G KFHAHKLVLAARS VFE EF D MEEDN EIV+TDME VFKALLH+IY+D Sbjct: 203 TFNVAGEKFHAHKLVLAARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKD 260 >ref|XP_006443499.1| hypothetical protein CICLE_v10020215mg [Citrus clementina] gi|568850979|ref|XP_006479172.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like isoform X1 [Citrus sinensis] gi|557545761|gb|ESR56739.1| hypothetical protein CICLE_v10020215mg [Citrus clementina] Length = 434 Score = 92.4 bits (228), Expect = 1e-16 Identities = 46/58 (79%), Positives = 50/58 (86%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV+G KFHAHKLVLAARS VFE EF D MEEDN EIV+TDME VFKALLH+IY+D Sbjct: 203 TFNVAGEKFHAHKLVLAARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKD 260 >gb|KDO66066.1| hypothetical protein CISIN_1g013880mg [Citrus sinensis] Length = 368 Score = 91.3 bits (225), Expect = 3e-16 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLAARS VFE EF D MEEDN EIV+TDME VFKALLH+IY+D Sbjct: 203 TFNVVGEKFHAHKLVLAARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKD 260 >gb|KDO66065.1| hypothetical protein CISIN_1g013880mg [Citrus sinensis] Length = 359 Score = 91.3 bits (225), Expect = 3e-16 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLAARS VFE EF D MEEDN EIV+TDME VFKALLH+IY+D Sbjct: 203 TFNVVGEKFHAHKLVLAARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKD 260 >gb|KDO66064.1| hypothetical protein CISIN_1g013880mg [Citrus sinensis] Length = 434 Score = 91.3 bits (225), Expect = 3e-16 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLAARS VFE EF D MEEDN EIV+TDME VFKALLH+IY+D Sbjct: 203 TFNVVGEKFHAHKLVLAARSPVFETEFLDAMEEDNHEIVVTDMEPKVFKALLHFIYKD 260 >ref|XP_007202130.1| hypothetical protein PRUPE_ppa006091mg [Prunus persica] gi|462397661|gb|EMJ03329.1| hypothetical protein PRUPE_ppa006091mg [Prunus persica] Length = 427 Score = 91.3 bits (225), Expect = 3e-16 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV GVKFHAHKLVLAARS FE EF +GMEEDNREIV+ DME VFKALLH+IY D Sbjct: 197 TFNVRGVKFHAHKLVLAARSPEFESEFLNGMEEDNREIVVVDMEPKVFKALLHFIYTD 254 >ref|XP_007029996.1| BTB-POZ and MATH domain 4 isoform 2 [Theobroma cacao] gi|508718601|gb|EOY10498.1| BTB-POZ and MATH domain 4 isoform 2 [Theobroma cacao] Length = 357 Score = 90.5 bits (223), Expect = 4e-16 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLA+RS VFE EF D MEEDN EIV+TDME VFKALLH+IYRD Sbjct: 192 TFNVFGEKFHAHKLVLASRSPVFEAEFSDRMEEDNNEIVVTDMEPKVFKALLHFIYRD 249 >ref|XP_007029995.1| BTB-POZ and MATH domain 4 isoform 1 [Theobroma cacao] gi|508718600|gb|EOY10497.1| BTB-POZ and MATH domain 4 isoform 1 [Theobroma cacao] Length = 423 Score = 90.5 bits (223), Expect = 4e-16 Identities = 46/58 (79%), Positives = 49/58 (84%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLA+RS VFE EF D MEEDN EIV+TDME VFKALLH+IYRD Sbjct: 192 TFNVFGEKFHAHKLVLASRSPVFEAEFSDRMEEDNNEIVVTDMEPKVFKALLHFIYRD 249 >ref|XP_012070393.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform X3 [Jatropha curcas] Length = 357 Score = 89.7 bits (221), Expect = 7e-16 Identities = 45/58 (77%), Positives = 50/58 (86%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLAARS VFE EF D +EEDNREIV++DME VFKALLH+IY+D Sbjct: 195 TFNVHGEKFHAHKLVLAARSPVFENEFFDLLEEDNREIVVSDMEPKVFKALLHFIYKD 252 >ref|XP_012070390.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform X1 [Jatropha curcas] gi|802585374|ref|XP_012070392.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform X2 [Jatropha curcas] gi|643732556|gb|KDP39652.1| hypothetical protein JCGZ_02672 [Jatropha curcas] Length = 424 Score = 89.7 bits (221), Expect = 7e-16 Identities = 45/58 (77%), Positives = 50/58 (86%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLAARS VFE EF D +EEDNREIV++DME VFKALLH+IY+D Sbjct: 195 TFNVHGEKFHAHKLVLAARSPVFENEFFDLLEEDNREIVVSDMEPKVFKALLHFIYKD 252 >ref|XP_008244139.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 [Prunus mume] Length = 427 Score = 89.4 bits (220), Expect = 1e-15 Identities = 45/58 (77%), Positives = 48/58 (82%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV GVKFHAHKLVLAARS FE EF +GMEEDN EIV+ DME VFKALLH+IY D Sbjct: 197 TFNVRGVKFHAHKLVLAARSPEFESEFLNGMEEDNHEIVVVDMEPKVFKALLHFIYTD 254 >gb|KOM38595.1| hypothetical protein LR48_Vigan03g197700 [Vigna angularis] Length = 431 Score = 88.2 bits (217), Expect = 2e-15 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TF+V G +FHAHKLVLAARS+ FE EF +GMEED R+IV+TDME VFKALLH+IYRD Sbjct: 199 TFSVGGERFHAHKLVLAARSTAFETEFFNGMEEDERDIVVTDMEPKVFKALLHFIYRD 256 >ref|XP_012492474.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform X2 [Gossypium raimondii] Length = 339 Score = 87.4 bits (215), Expect = 4e-15 Identities = 43/57 (75%), Positives = 46/57 (80%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEFDGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLAARS VFE EF ED+ EIV+TDME VFKALLH+IYRD Sbjct: 109 TFNVFGEKFHAHKLVLAARSPVFEAEFSDRMEDDNEIVVTDMEPKVFKALLHFIYRD 165 >gb|KJB44500.1| hypothetical protein B456_007G255900 [Gossypium raimondii] Length = 346 Score = 87.4 bits (215), Expect = 4e-15 Identities = 43/57 (75%), Positives = 46/57 (80%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEFDGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLAARS VFE EF ED+ EIV+TDME VFKALLH+IYRD Sbjct: 192 TFNVFGEKFHAHKLVLAARSPVFEAEFSDRMEDDNEIVVTDMEPKVFKALLHFIYRD 248 >gb|KJB44499.1| hypothetical protein B456_007G255900 [Gossypium raimondii] gi|763777378|gb|KJB44501.1| hypothetical protein B456_007G255900 [Gossypium raimondii] Length = 348 Score = 87.4 bits (215), Expect = 4e-15 Identities = 43/57 (75%), Positives = 46/57 (80%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEFDGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLAARS VFE EF ED+ EIV+TDME VFKALLH+IYRD Sbjct: 192 TFNVFGEKFHAHKLVLAARSPVFEAEFSDRMEDDNEIVVTDMEPKVFKALLHFIYRD 248 >ref|XP_012492473.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4 isoform X1 [Gossypium raimondii] gi|763777375|gb|KJB44498.1| hypothetical protein B456_007G255900 [Gossypium raimondii] Length = 422 Score = 87.4 bits (215), Expect = 4e-15 Identities = 43/57 (75%), Positives = 46/57 (80%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEFDGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLAARS VFE EF ED+ EIV+TDME VFKALLH+IYRD Sbjct: 192 TFNVFGEKFHAHKLVLAARSPVFEAEFSDRMEDDNEIVVTDMEPKVFKALLHFIYRD 248 >gb|KHG25171.1| BTB/POZ and MATH domain-containing 4 -like protein [Gossypium arboreum] Length = 467 Score = 87.4 bits (215), Expect = 4e-15 Identities = 43/57 (75%), Positives = 46/57 (80%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEFDGMEEDNREIVITDMESDVFKALLHYIYRD 41 TFNV G KFHAHKLVLAARS VFE EF ED+ EIV+TDME VFKALLH+IYRD Sbjct: 192 TFNVFGEKFHAHKLVLAARSPVFEAEFSDRMEDDNEIVVTDMEPKVFKALLHFIYRD 248 >ref|XP_014491313.1| PREDICTED: BTB/POZ and MATH domain-containing protein 4-like [Vigna radiata var. radiata] Length = 431 Score = 86.7 bits (213), Expect = 6e-15 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 1/58 (1%) Frame = -3 Query: 211 TFNVSGVKFHAHKLVLAARSSVFEKEF-DGMEEDNREIVITDMESDVFKALLHYIYRD 41 TF+V G +FHAHKLVLAARS+ FE EF +GMEED ++IV+TDME VFKALLH+IYRD Sbjct: 199 TFSVGGERFHAHKLVLAARSTAFETEFFNGMEEDEQDIVVTDMEPKVFKALLHFIYRD 256