BLASTX nr result
ID: Ziziphus21_contig00010096
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00010096 (498 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010111399.1| 60S ribosomal protein L6 [Morus notabilis] g... 82 4e-25 ref|XP_010089731.1| 60S ribosomal protein L6 [Morus notabilis] g... 76 6e-24 ref|XP_007221500.1| hypothetical protein PRUPE_ppa010844mg [Prun... 77 4e-23 ref|XP_008387243.1| PREDICTED: 60S ribosomal protein L6-like [Ma... 77 4e-23 ref|XP_009369866.1| PREDICTED: 60S ribosomal protein L6-like [Py... 77 7e-23 ref|XP_009352593.1| PREDICTED: 60S ribosomal protein L6-like iso... 75 7e-23 ref|XP_008337622.1| PREDICTED: 60S ribosomal protein L6-like [Ma... 75 7e-23 ref|XP_009352594.1| PREDICTED: 60S ribosomal protein L6-like iso... 75 7e-23 ref|XP_008344225.1| PREDICTED: 60S ribosomal protein L6-like [Ma... 75 7e-23 ref|XP_008387473.1| PREDICTED: 60S ribosomal protein L6-like [Ma... 74 1e-22 ref|XP_008227773.1| PREDICTED: 60S ribosomal protein L6-like [Pr... 75 3e-22 gb|KDO37112.1| hypothetical protein CISIN_1g026764mg [Citrus sin... 78 4e-22 ref|XP_006485022.1| PREDICTED: 60S ribosomal protein L6-like [Ci... 78 4e-22 ref|XP_006437047.1| hypothetical protein CICLE_v10032633mg [Citr... 78 4e-22 ref|XP_008240963.1| PREDICTED: 60S ribosomal protein L6-3-like [... 75 5e-22 ref|XP_008367370.1| PREDICTED: 60S ribosomal protein L6-like [Ma... 75 5e-22 ref|XP_010557777.1| PREDICTED: 60S ribosomal protein L6-1-like [... 72 5e-22 ref|XP_007202511.1| hypothetical protein PRUPE_ppa010838mg [Prun... 74 7e-22 gb|KHN49031.1| 60S ribosomal protein L6 [Glycine soja] 74 7e-22 ref|XP_003546871.1| PREDICTED: 60S ribosomal protein L6-like [Gl... 74 7e-22 >ref|XP_010111399.1| 60S ribosomal protein L6 [Morus notabilis] gi|587944395|gb|EXC30877.1| 60S ribosomal protein L6 [Morus notabilis] Length = 234 Score = 82.4 bits (202), Expect(2) = 4e-25 Identities = 36/41 (87%), Positives = 36/41 (87%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HD KPAAE PPQKPPKFYPADDVKKP VNKRKHKP KLR Sbjct: 47 PRHDAKPAAEAPPQKPPKFYPADDVKKPLVNKRKHKPTKLR 87 Score = 58.9 bits (141), Expect(2) = 4e-25 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRVVFLKQLSSGLLLV Sbjct: 86 LRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLV 121 >ref|XP_010089731.1| 60S ribosomal protein L6 [Morus notabilis] gi|587847989|gb|EXB38292.1| 60S ribosomal protein L6 [Morus notabilis] Length = 360 Score = 75.9 bits (185), Expect(2) = 6e-24 Identities = 33/41 (80%), Positives = 35/41 (85%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HDPKPA ++P QKPPKFYPADDVKKP VNKRK KP KLR Sbjct: 46 PRHDPKPAIDSPLQKPPKFYPADDVKKPLVNKRKPKPTKLR 86 Score = 61.6 bits (148), Expect(2) = 6e-24 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SITLGTVLI+L RFKGKRVVFLKQLSSGLLLV Sbjct: 85 LRASITLGTVLIILAGRFKGKRVVFLKQLSSGLLLV 120 >ref|XP_007221500.1| hypothetical protein PRUPE_ppa010844mg [Prunus persica] gi|462418250|gb|EMJ22699.1| hypothetical protein PRUPE_ppa010844mg [Prunus persica] Length = 233 Score = 77.4 bits (189), Expect(2) = 4e-23 Identities = 34/41 (82%), Positives = 34/41 (82%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HDPKPAAE P QKPPKFYPADDVKKP VNKRK KP LR Sbjct: 46 PRHDPKPAAETPTQKPPKFYPADDVKKPLVNKRKPKPTNLR 86 Score = 57.4 bits (137), Expect(2) = 4e-23 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRV+FLKQL+SGLLLV Sbjct: 85 LRASITPGTVLIILAGRFKGKRVIFLKQLTSGLLLV 120 >ref|XP_008387243.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica] Length = 233 Score = 77.0 bits (188), Expect(2) = 4e-23 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HDPKPAAE P+KPPKFYPADDVKKP VNKRK KP KLR Sbjct: 46 PCHDPKPAAETAPEKPPKFYPADDVKKPLVNKRKPKPTKLR 86 Score = 57.8 bits (138), Expect(2) = 4e-23 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRVVFLKQL SGLLLV Sbjct: 85 LRASITXGTVLIILAGRFKGKRVVFLKQLPSGLLLV 120 >ref|XP_009369866.1| PREDICTED: 60S ribosomal protein L6-like [Pyrus x bretschneideri] Length = 233 Score = 77.0 bits (188), Expect(2) = 7e-23 Identities = 34/41 (82%), Positives = 35/41 (85%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HDPKPAAE P+KPPKFYPADDVKKP VNKRK KP KLR Sbjct: 46 PCHDPKPAAETAPEKPPKFYPADDVKKPLVNKRKPKPTKLR 86 Score = 57.0 bits (136), Expect(2) = 7e-23 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRVVFLKQL SGLLLV Sbjct: 85 LRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV 120 >ref|XP_009352593.1| PREDICTED: 60S ribosomal protein L6-like isoform X1 [Pyrus x bretschneideri] Length = 233 Score = 75.1 bits (183), Expect(2) = 7e-23 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HD KPAAE P+KPPKFYPADDVKKP VNKRK KP KLR Sbjct: 46 PRHDAKPAAETQPEKPPKFYPADDVKKPLVNKRKPKPTKLR 86 Score = 58.9 bits (141), Expect(2) = 7e-23 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRVVFLKQLSSGLLLV Sbjct: 85 LRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLV 120 >ref|XP_008337622.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica] gi|658033672|ref|XP_008352349.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica] Length = 233 Score = 75.1 bits (183), Expect(2) = 7e-23 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HD KPAAE P+KPPKFYPADDVKKP VNKRK KP KLR Sbjct: 46 PRHDAKPAAETQPEKPPKFYPADDVKKPLVNKRKPKPTKLR 86 Score = 58.9 bits (141), Expect(2) = 7e-23 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRVVFLKQLSSGLLLV Sbjct: 85 LRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLV 120 >ref|XP_009352594.1| PREDICTED: 60S ribosomal protein L6-like isoform X2 [Pyrus x bretschneideri] Length = 217 Score = 75.1 bits (183), Expect(2) = 7e-23 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HD KPAAE P+KPPKFYPADDVKKP VNKRK KP KLR Sbjct: 46 PRHDAKPAAETQPEKPPKFYPADDVKKPLVNKRKPKPTKLR 86 Score = 58.9 bits (141), Expect(2) = 7e-23 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRVVFLKQLSSGLLLV Sbjct: 85 LRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLV 120 >ref|XP_008344225.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica] Length = 124 Score = 75.1 bits (183), Expect(2) = 7e-23 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HD KPAAE P+KPPKFYPADDVKKP VNKRK KP KLR Sbjct: 46 PRHDAKPAAETQPEKPPKFYPADDVKKPLVNKRKPKPTKLR 86 Score = 58.9 bits (141), Expect(2) = 7e-23 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRVVFLKQLSSGLLLV Sbjct: 85 LRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLV 120 >ref|XP_008387473.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica] gi|658037741|ref|XP_008354425.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica] Length = 185 Score = 73.9 bits (180), Expect(2) = 1e-22 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HD KPAAE P+KPPKFYPADDVKKP VNKRK +P KLR Sbjct: 46 PRHDAKPAAETQPEKPPKFYPADDVKKPLVNKRKPRPTKLR 86 Score = 59.3 bits (142), Expect(2) = 1e-22 Identities = 32/36 (88%), Positives = 32/36 (88%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLIVL RFKGKRVVFLKQLSSGLLLV Sbjct: 85 LRASITPGTVLIVLAGRFKGKRVVFLKQLSSGLLLV 120 >ref|XP_008227773.1| PREDICTED: 60S ribosomal protein L6-like [Prunus mume] Length = 233 Score = 75.1 bits (183), Expect(2) = 3e-22 Identities = 33/41 (80%), Positives = 33/41 (80%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HDPKPAAE P QKPPKFYPADD KKP VNKRK KP LR Sbjct: 46 PRHDPKPAAEAPTQKPPKFYPADDAKKPLVNKRKPKPTNLR 86 Score = 56.6 bits (135), Expect(2) = 3e-22 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR +IT GTVLI+L RFKGKRVVFLKQL+SGLLLV Sbjct: 85 LRATITPGTVLIILAGRFKGKRVVFLKQLTSGLLLV 120 >gb|KDO37112.1| hypothetical protein CISIN_1g026764mg [Citrus sinensis] Length = 233 Score = 78.2 bits (191), Expect(2) = 4e-22 Identities = 34/41 (82%), Positives = 34/41 (82%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HDPKPAA P KPPKFYPADDVKKP VNKRKHKP KLR Sbjct: 46 PKHDPKPAAAETPAKPPKFYPADDVKKPLVNKRKHKPTKLR 86 Score = 53.1 bits (126), Expect(2) = 4e-22 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTV I+L RF GKRVVFLKQL+SGLLLV Sbjct: 85 LRASITPGTVFILLAGRFMGKRVVFLKQLTSGLLLV 120 >ref|XP_006485022.1| PREDICTED: 60S ribosomal protein L6-like [Citrus sinensis] Length = 233 Score = 78.2 bits (191), Expect(2) = 4e-22 Identities = 34/41 (82%), Positives = 34/41 (82%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HDPKPAA P KPPKFYPADDVKKP VNKRKHKP KLR Sbjct: 46 PKHDPKPAAAETPAKPPKFYPADDVKKPLVNKRKHKPTKLR 86 Score = 53.1 bits (126), Expect(2) = 4e-22 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTV I+L RF GKRVVFLKQL+SGLLLV Sbjct: 85 LRASITPGTVFILLAGRFMGKRVVFLKQLTSGLLLV 120 >ref|XP_006437047.1| hypothetical protein CICLE_v10032633mg [Citrus clementina] gi|557539243|gb|ESR50287.1| hypothetical protein CICLE_v10032633mg [Citrus clementina] Length = 233 Score = 78.2 bits (191), Expect(2) = 4e-22 Identities = 34/41 (82%), Positives = 34/41 (82%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HDPKPAA P KPPKFYPADDVKKP VNKRKHKP KLR Sbjct: 46 PKHDPKPAAAETPAKPPKFYPADDVKKPLVNKRKHKPTKLR 86 Score = 53.1 bits (126), Expect(2) = 4e-22 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTV I+L RF GKRVVFLKQL+SGLLLV Sbjct: 85 LRASITPGTVFILLAGRFMGKRVVFLKQLTSGLLLV 120 >ref|XP_008240963.1| PREDICTED: 60S ribosomal protein L6-3-like [Prunus mume] Length = 233 Score = 75.1 bits (183), Expect(2) = 5e-22 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HD KPAAE PQKPPKFYPADDV+KP VNKRK KP KLR Sbjct: 46 PRHDAKPAAETQPQKPPKFYPADDVRKPLVNKRKAKPTKLR 86 Score = 55.8 bits (133), Expect(2) = 5e-22 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR +IT GTVLI+L RFKGKRVVFLKQL SGLLLV Sbjct: 85 LRATITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV 120 >ref|XP_008367370.1| PREDICTED: 60S ribosomal protein L6-like [Malus domestica] Length = 233 Score = 74.7 bits (182), Expect(2) = 5e-22 Identities = 33/41 (80%), Positives = 34/41 (82%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HDPKPAAE +KPPKFYPADDVKKP VNKRK KP KLR Sbjct: 46 PSHDPKPAAETASEKPPKFYPADDVKKPLVNKRKPKPTKLR 86 Score = 56.2 bits (134), Expect(2) = 5e-22 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GT+LI+L RFKGKRVVFLKQL SGLLLV Sbjct: 85 LRASITRGTLLIILAGRFKGKRVVFLKQLPSGLLLV 120 >ref|XP_010557777.1| PREDICTED: 60S ribosomal protein L6-1-like [Tarenaya hassleriana] Length = 232 Score = 72.0 bits (175), Expect(2) = 5e-22 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 PHHDPKP E P +K PKFYPA+DVKKP VNKRK KP KLR Sbjct: 45 PHHDPKPKPEAPAEKTPKFYPAEDVKKPLVNKRKPKPTKLR 85 Score = 58.9 bits (141), Expect(2) = 5e-22 Identities = 31/36 (86%), Positives = 32/36 (88%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRVVFLKQLSSGLLLV Sbjct: 84 LRASITPGTVLIILAGRFKGKRVVFLKQLSSGLLLV 119 >ref|XP_007202511.1| hypothetical protein PRUPE_ppa010838mg [Prunus persica] gi|462398042|gb|EMJ03710.1| hypothetical protein PRUPE_ppa010838mg [Prunus persica] Length = 233 Score = 73.6 bits (179), Expect(2) = 7e-22 Identities = 33/41 (80%), Positives = 33/41 (80%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HD KPAA PQKPPKFYPADDVKKP VNKRK KP KLR Sbjct: 46 PRHDAKPAAVTQPQKPPKFYPADDVKKPLVNKRKAKPTKLR 86 Score = 57.0 bits (136), Expect(2) = 7e-22 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRVVFLKQL SGLLLV Sbjct: 85 LRASITPGTVLIILAGRFKGKRVVFLKQLPSGLLLV 120 >gb|KHN49031.1| 60S ribosomal protein L6 [Glycine soja] Length = 232 Score = 74.3 bits (181), Expect(2) = 7e-22 Identities = 33/41 (80%), Positives = 33/41 (80%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HDPKP E P QKPPKFYPADDVKKP VNK K KPAKLR Sbjct: 45 PRHDPKPKPEAPAQKPPKFYPADDVKKPLVNKHKPKPAKLR 85 Score = 56.2 bits (134), Expect(2) = 7e-22 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRVVFLKQL SGLLLV Sbjct: 84 LRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLV 119 >ref|XP_003546871.1| PREDICTED: 60S ribosomal protein L6-like [Glycine max] gi|947064640|gb|KRH13901.1| hypothetical protein GLYMA_15G271300 [Glycine max] Length = 232 Score = 74.3 bits (181), Expect(2) = 7e-22 Identities = 33/41 (80%), Positives = 33/41 (80%) Frame = -2 Query: 497 PHHDPKPAAENPPQKPPKFYPADDVKKPFVNKRKHKPAKLR 375 P HDPKP E P QKPPKFYPADDVKKP VNK K KPAKLR Sbjct: 45 PRHDPKPKPEAPAQKPPKFYPADDVKKPLVNKHKPKPAKLR 85 Score = 56.2 bits (134), Expect(2) = 7e-22 Identities = 30/36 (83%), Positives = 31/36 (86%) Frame = -3 Query: 265 LRTSITLGTVLIVLVRRFKGKRVVFLKQLSSGLLLV 158 LR SIT GTVLI+L RFKGKRVVFLKQL SGLLLV Sbjct: 84 LRASITPGTVLILLAGRFKGKRVVFLKQLPSGLLLV 119