BLASTX nr result
ID: Ziziphus21_contig00009572
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00009572 (275 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008797139.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 2e-19 ref|XP_008797138.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 2e-19 ref|XP_008797137.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 2e-19 ref|XP_010683894.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 3e-19 ref|XP_009359867.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 3e-19 ref|XP_008369616.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 3e-19 ref|XP_008369615.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 3e-19 ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea ma... 101 3e-19 ref|XP_008666922.1| PREDICTED: uncharacterized protein LOC100272... 101 3e-19 ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 101 3e-19 ref|XP_008666941.1| PREDICTED: uncharacterized protein LOC100272... 101 3e-19 ref|XP_008666933.1| PREDICTED: uncharacterized protein LOC100272... 101 3e-19 gb|KHG16037.1| Peptidyl-prolyl cis-trans isomerase FKBP19, chlor... 100 3e-19 ref|XP_002445577.1| hypothetical protein SORBIDRAFT_07g021890 [S... 100 3e-19 ref|XP_008222259.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 100 7e-19 ref|XP_008222258.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 100 7e-19 gb|KDO58143.1| hypothetical protein CISIN_1g038431mg [Citrus sin... 100 7e-19 ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 100 7e-19 ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citr... 100 7e-19 ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citr... 100 7e-19 >ref|XP_008797139.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X3 [Phoenix dactylifera] Length = 230 Score = 101 bits (252), Expect = 2e-19 Identities = 55/86 (63%), Positives = 57/86 (66%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPELGYPDND+NK+GPRPTTFS GQRAL Sbjct: 174 RIIVPPELGYPDNDFNKLGPRPTTFS-----------------------------GQRAL 204 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 205 DFVLRNQGLIDKTLLFDIELLKIIPN 230 >ref|XP_008797138.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X2 [Phoenix dactylifera] Length = 242 Score = 101 bits (252), Expect = 2e-19 Identities = 55/86 (63%), Positives = 57/86 (66%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPELGYPDND+NK+GPRPTTFS GQRAL Sbjct: 186 RIIVPPELGYPDNDFNKLGPRPTTFS-----------------------------GQRAL 216 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 217 DFVLRNQGLIDKTLLFDIELLKIIPN 242 >ref|XP_008797137.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X1 [Phoenix dactylifera] Length = 257 Score = 101 bits (252), Expect = 2e-19 Identities = 55/86 (63%), Positives = 57/86 (66%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPELGYPDND+NK+GPRPTTFS GQRAL Sbjct: 201 RIIVPPELGYPDNDFNKLGPRPTTFS-----------------------------GQRAL 231 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 232 DFVLRNQGLIDKTLLFDIELLKIIPN 257 >ref|XP_010683894.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic [Beta vulgaris subsp. vulgaris] gi|870854607|gb|KMT06362.1| hypothetical protein BVRB_7g160440 [Beta vulgaris subsp. vulgaris] Length = 307 Score = 101 bits (251), Expect = 3e-19 Identities = 55/86 (63%), Positives = 56/86 (65%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPELGYPDNDYNK GPRPTTFS GQRAL Sbjct: 251 RIIVPPELGYPDNDYNKKGPRPTTFS-----------------------------GQRAL 281 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIEL+KIIPN Sbjct: 282 DFVLRNQGLIDKTLLFDIELMKIIPN 307 >ref|XP_009359867.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Pyrus x bretschneideri] Length = 261 Score = 101 bits (251), Expect = 3e-19 Identities = 55/86 (63%), Positives = 56/86 (65%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPELGYPDNDYNK GPRPTTFS GQRAL Sbjct: 205 RIIVPPELGYPDNDYNKSGPRPTTFS-----------------------------GQRAL 235 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIEL+KIIPN Sbjct: 236 DFVLRNQGLIDKTLLFDIELIKIIPN 261 >ref|XP_008369616.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X2 [Malus domestica] Length = 255 Score = 101 bits (251), Expect = 3e-19 Identities = 55/86 (63%), Positives = 56/86 (65%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPELGYPDNDYNK GPRPTTFS GQRAL Sbjct: 199 RIIVPPELGYPDNDYNKSGPRPTTFS-----------------------------GQRAL 229 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIEL+KIIPN Sbjct: 230 DFVLRNQGLIDKTLLFDIELIKIIPN 255 >ref|XP_008369615.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X1 [Malus domestica] Length = 261 Score = 101 bits (251), Expect = 3e-19 Identities = 55/86 (63%), Positives = 56/86 (65%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPELGYPDNDYNK GPRPTTFS GQRAL Sbjct: 205 RIIVPPELGYPDNDYNKSGPRPTTFS-----------------------------GQRAL 235 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIEL+KIIPN Sbjct: 236 DFVLRNQGLIDKTLLFDIELIKIIPN 261 >ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea mays] gi|670358760|ref|XP_008666916.1| PREDICTED: uncharacterized protein LOC100272703 isoform X1 [Zea mays] gi|194700240|gb|ACF84204.1| unknown [Zea mays] gi|414870311|tpg|DAA48868.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870312|tpg|DAA48869.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 240 Score = 101 bits (251), Expect = 3e-19 Identities = 54/87 (62%), Positives = 58/87 (66%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPP+LGYPDNDYNK+GP+PTTFS GQRAL Sbjct: 183 RIIVPPDLGYPDNDYNKLGPKPTTFS-----------------------------GQRAL 213 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPNR 261 DFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 214 DFVLRNQGLIDKTLLFDIELLKIIPNQ 240 >ref|XP_008666922.1| PREDICTED: uncharacterized protein LOC100272703 isoform X2 [Zea mays] gi|670358764|ref|XP_008666926.1| PREDICTED: uncharacterized protein LOC100272703 isoform X2 [Zea mays] gi|194696764|gb|ACF82466.1| unknown [Zea mays] gi|195641426|gb|ACG40181.1| FK506 binding protein [Zea mays] gi|414870313|tpg|DAA48870.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870314|tpg|DAA48871.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 232 Score = 101 bits (251), Expect = 3e-19 Identities = 54/87 (62%), Positives = 58/87 (66%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPP+LGYPDNDYNK+GP+PTTFS GQRAL Sbjct: 175 RIIVPPDLGYPDNDYNKLGPKPTTFS-----------------------------GQRAL 205 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPNR 261 DFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 206 DFVLRNQGLIDKTLLFDIELLKIIPNQ 232 >ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic [Setaria italica] gi|944232195|gb|KQK96557.1| hypothetical protein SETIT_011042mg [Setaria italica] Length = 214 Score = 101 bits (251), Expect = 3e-19 Identities = 54/87 (62%), Positives = 58/87 (66%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPP+LGYPDNDYNK+GP+PTTFS GQRAL Sbjct: 157 RIIVPPDLGYPDNDYNKLGPKPTTFS-----------------------------GQRAL 187 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPNR 261 DFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 188 DFVLRNQGLIDKTLLFDIELLKIIPNQ 214 >ref|XP_008666941.1| PREDICTED: uncharacterized protein LOC100272703 isoform X4 [Zea mays] gi|414870317|tpg|DAA48874.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 198 Score = 101 bits (251), Expect = 3e-19 Identities = 54/87 (62%), Positives = 58/87 (66%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPP+LGYPDNDYNK+GP+PTTFS GQRAL Sbjct: 141 RIIVPPDLGYPDNDYNKLGPKPTTFS-----------------------------GQRAL 171 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPNR 261 DFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 172 DFVLRNQGLIDKTLLFDIELLKIIPNQ 198 >ref|XP_008666933.1| PREDICTED: uncharacterized protein LOC100272703 isoform X3 [Zea mays] gi|414870315|tpg|DAA48872.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Zea mays] gi|414870316|tpg|DAA48873.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Zea mays] Length = 214 Score = 101 bits (251), Expect = 3e-19 Identities = 54/87 (62%), Positives = 58/87 (66%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPP+LGYPDNDYNK+GP+PTTFS GQRAL Sbjct: 157 RIIVPPDLGYPDNDYNKLGPKPTTFS-----------------------------GQRAL 187 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPNR 261 DFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 188 DFVLRNQGLIDKTLLFDIELLKIIPNQ 214 >gb|KHG16037.1| Peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic -like protein [Gossypium arboreum] Length = 247 Score = 100 bits (250), Expect = 3e-19 Identities = 55/86 (63%), Positives = 56/86 (65%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPELGYPDNDYNK GP+PTTFS GQRAL Sbjct: 191 RIIVPPELGYPDNDYNKSGPKPTTFS-----------------------------GQRAL 221 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 222 DFVLRNQGLIDKTLLFDIELLKIIPN 247 >ref|XP_002445577.1| hypothetical protein SORBIDRAFT_07g021890 [Sorghum bicolor] gi|241941927|gb|EES15072.1| hypothetical protein SORBIDRAFT_07g021890 [Sorghum bicolor] Length = 207 Score = 100 bits (250), Expect = 3e-19 Identities = 54/86 (62%), Positives = 57/86 (66%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPP+LGYPDNDYNK+GP+PTTFS GQRAL Sbjct: 151 RIIVPPDLGYPDNDYNKLGPKPTTFS-----------------------------GQRAL 181 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 182 DFVLRNQGLIDKTLLFDIELLKIIPN 207 >ref|XP_008222259.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X2 [Prunus mume] Length = 259 Score = 99.8 bits (247), Expect = 7e-19 Identities = 54/86 (62%), Positives = 56/86 (65%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPELGYP+NDYNK GPRPTTFS GQRAL Sbjct: 203 RIIVPPELGYPENDYNKSGPRPTTFS-----------------------------GQRAL 233 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIEL+KIIPN Sbjct: 234 DFVLRNQGLIDKTLLFDIELIKIIPN 259 >ref|XP_008222258.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic isoform X1 [Prunus mume] Length = 262 Score = 99.8 bits (247), Expect = 7e-19 Identities = 54/86 (62%), Positives = 56/86 (65%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPELGYP+NDYNK GPRPTTFS GQRAL Sbjct: 206 RIIVPPELGYPENDYNKSGPRPTTFS-----------------------------GQRAL 236 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIEL+KIIPN Sbjct: 237 DFVLRNQGLIDKTLLFDIELIKIIPN 262 >gb|KDO58143.1| hypothetical protein CISIN_1g038431mg [Citrus sinensis] Length = 267 Score = 99.8 bits (247), Expect = 7e-19 Identities = 54/86 (62%), Positives = 56/86 (65%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPE+GYP+NDYNK GPRPTTFS GQRAL Sbjct: 211 RIIVPPEIGYPENDYNKSGPRPTTFS-----------------------------GQRAL 241 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 242 DFVLRNQGLIDKTLLFDIELLKIIPN 267 >ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X1 [Citrus sinensis] Length = 267 Score = 99.8 bits (247), Expect = 7e-19 Identities = 54/86 (62%), Positives = 56/86 (65%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPE+GYP+NDYNK GPRPTTFS GQRAL Sbjct: 211 RIIVPPEIGYPENDYNKSGPRPTTFS-----------------------------GQRAL 241 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 242 DFVLRNQGLIDKTLLFDIELLKIIPN 267 >ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522685|gb|ESR34052.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 250 Score = 99.8 bits (247), Expect = 7e-19 Identities = 54/86 (62%), Positives = 56/86 (65%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPE+GYP+NDYNK GPRPTTFS GQRAL Sbjct: 194 RIIVPPEIGYPENDYNKSGPRPTTFS-----------------------------GQRAL 224 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 225 DFVLRNQGLIDKTLLFDIELLKIIPN 250 >ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|567855379|ref|XP_006420809.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522681|gb|ESR34048.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522682|gb|ESR34049.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 267 Score = 99.8 bits (247), Expect = 7e-19 Identities = 54/86 (62%), Positives = 56/86 (65%) Frame = +1 Query: 1 RIIVPPELGYPDNDYNKMGPRPTTFSVILECGFRXXXXXXXXVNSDLRGNSDLSQGQRAL 180 RIIVPPE+GYP+NDYNK GPRPTTFS GQRAL Sbjct: 211 RIIVPPEIGYPENDYNKSGPRPTTFS-----------------------------GQRAL 241 Query: 181 DFVLRNQGLIDKTLLFDIELLKIIPN 258 DFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 242 DFVLRNQGLIDKTLLFDIELLKIIPN 267