BLASTX nr result
ID: Ziziphus21_contig00009086
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00009086 (403 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010087181.1| hypothetical protein L484_003821 [Morus nota... 58 2e-06 >ref|XP_010087181.1| hypothetical protein L484_003821 [Morus notabilis] gi|587837683|gb|EXB28438.1| hypothetical protein L484_003821 [Morus notabilis] Length = 378 Score = 58.2 bits (139), Expect = 2e-06 Identities = 34/74 (45%), Positives = 38/74 (51%), Gaps = 2/74 (2%) Frame = -1 Query: 274 SSQPFFHSPSPLAFPSLNLKP--FSLTPLPNSPFVVRXXXXXXXXXXXXXXXXXXXXXXX 101 ++ PF H PSPLAFP L L+P TP PNSPFVVR Sbjct: 22 AASPFLHYPSPLAFPILKLRPALSPQTPPPNSPFVVRADDGDGDSGGPDDYDMDDEEVEE 81 Query: 100 XDNKKDFDIEYDTL 59 DNKKDFDIEY+ L Sbjct: 82 VDNKKDFDIEYEPL 95