BLASTX nr result
ID: Ziziphus21_contig00006766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00006766 (527 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_009176028.1| clp protease proteolytic subunit (chloroplas... 55 9e-08 >ref|YP_009176028.1| clp protease proteolytic subunit (chloroplast) [Ficus racemosa] gi|937500965|gb|ALI30724.1| clp protease proteolytic subunit (chloroplast) [Ficus racemosa] Length = 267 Score = 55.1 bits (131), Expect(2) = 9e-08 Identities = 25/28 (89%), Positives = 25/28 (89%) Frame = -2 Query: 85 FFAICVEPYASKGACTVPKGYNFIPINR 2 FFAICVE YASK ACTVPKGYNFI INR Sbjct: 65 FFAICVELYASKDACTVPKGYNFISINR 92 Score = 27.7 bits (60), Expect(2) = 9e-08 Identities = 18/43 (41%), Positives = 22/43 (51%) Frame = -3 Query: 210 KQAKTHLS*NMKEKAPLCYKLKRACYEYKKRKKARIYTLILFF 82 K+ KTH+ + K+P KK KK RIYTLIL F Sbjct: 26 KKTKTHIF-FYERKSPFVTSYTELAM--KKEKKTRIYTLILVF 65