BLASTX nr result
ID: Ziziphus21_contig00006547
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00006547 (288 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004290445.1| PREDICTED: ATP synthase delta chain, chlorop... 81 3e-13 ref|XP_008237347.1| PREDICTED: ATP synthase delta chain, chlorop... 80 5e-13 ref|XP_007201374.1| hypothetical protein PRUPE_ppa010263mg [Prun... 80 5e-13 ref|XP_011074150.1| PREDICTED: ATP synthase delta chain, chlorop... 79 1e-12 ref|XP_007022200.1| ATP synthase delta-subunit gene [Theobroma c... 79 1e-12 ref|XP_009339060.1| PREDICTED: LOW QUALITY PROTEIN: ATP synthase... 78 2e-12 ref|XP_008366147.1| PREDICTED: ATP synthase delta chain, chlorop... 78 2e-12 ref|XP_008381027.1| PREDICTED: ATP synthase delta chain, chlorop... 78 2e-12 ref|XP_011083403.1| PREDICTED: ATP synthase delta chain, chlorop... 78 3e-12 ref|XP_012453807.1| PREDICTED: ATP synthase subunit delta, chlor... 77 5e-12 ref|XP_011038195.1| PREDICTED: ATP synthase delta chain, chlorop... 77 5e-12 ref|XP_006376336.1| hypothetical protein POPTR_0013s12130g [Popu... 77 5e-12 ref|XP_008463069.1| PREDICTED: ATP synthase delta chain, chlorop... 77 7e-12 ref|XP_004138373.1| PREDICTED: ATP synthase subunit delta, chlor... 77 7e-12 ref|XP_003608818.1| F0F1-type ATP synthase, delta subunit [Medic... 77 7e-12 ref|XP_010530142.1| PREDICTED: ATP synthase delta chain, chlorop... 76 9e-12 gb|EPS71748.1| hypothetical protein M569_03009, partial [Genlise... 76 9e-12 ref|XP_010094830.1| ATP synthase delta chain [Morus notabilis] g... 75 2e-11 ref|XP_008358508.1| PREDICTED: ATP synthase delta chain, chlorop... 75 2e-11 ref|XP_012089674.1| PREDICTED: ATP synthase subunit delta, chlor... 75 2e-11 >ref|XP_004290445.1| PREDICTED: ATP synthase delta chain, chloroplastic [Fragaria vesca subsp. vesca] Length = 250 Score = 80.9 bits (198), Expect = 3e-13 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVRYGNSGSKLID+SVKKQLEEIAAQLDLGDIK Sbjct: 207 DPSLVAGFTVRYGNSGSKLIDMSVKKQLEEIAAQLDLGDIK 247 >ref|XP_008237347.1| PREDICTED: ATP synthase delta chain, chloroplastic [Prunus mume] Length = 257 Score = 80.5 bits (197), Expect = 5e-13 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAA+LDLGDIK Sbjct: 214 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAELDLGDIK 254 >ref|XP_007201374.1| hypothetical protein PRUPE_ppa010263mg [Prunus persica] gi|462396774|gb|EMJ02573.1| hypothetical protein PRUPE_ppa010263mg [Prunus persica] Length = 257 Score = 80.5 bits (197), Expect = 5e-13 Identities = 40/41 (97%), Positives = 41/41 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAA+LDLGDIK Sbjct: 214 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAELDLGDIK 254 >ref|XP_011074150.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Sesamum indicum] Length = 246 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFT+RYGNSGSKLID+SVKKQLEEIAAQLDLGDI+ Sbjct: 203 DPSLVAGFTIRYGNSGSKLIDMSVKKQLEEIAAQLDLGDIQ 243 >ref|XP_007022200.1| ATP synthase delta-subunit gene [Theobroma cacao] gi|508721828|gb|EOY13725.1| ATP synthase delta-subunit gene [Theobroma cacao] Length = 240 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFT+RYGNSGSKLID+SVKKQLEEIAAQLDLGDI+ Sbjct: 197 DPSLVAGFTIRYGNSGSKLIDMSVKKQLEEIAAQLDLGDIQ 237 >ref|XP_009339060.1| PREDICTED: LOW QUALITY PROTEIN: ATP synthase delta chain, chloroplastic-like [Pyrus x bretschneideri] Length = 312 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVRYG SGSKLIDLSVKKQLEEIAA+LDLGDIK Sbjct: 269 DPSLVAGFTVRYGQSGSKLIDLSVKKQLEEIAAELDLGDIK 309 >ref|XP_008366147.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Malus domestica] Length = 317 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVRYG SGSKLIDLSVKKQLEEIAA+LDLGDIK Sbjct: 274 DPSLVAGFTVRYGQSGSKLIDLSVKKQLEEIAAELDLGDIK 314 >ref|XP_008381027.1| PREDICTED: ATP synthase delta chain, chloroplastic [Malus domestica] Length = 253 Score = 78.2 bits (191), Expect = 2e-12 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVRYG SGSKLIDLSVKKQLEEIAA+LDLGDIK Sbjct: 210 DPSLVAGFTVRYGQSGSKLIDLSVKKQLEEIAAELDLGDIK 250 >ref|XP_011083403.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Sesamum indicum] Length = 269 Score = 77.8 bits (190), Expect = 3e-12 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFT+RYGNSGSKLID+SVKKQLEEIAA+LDLGDI+ Sbjct: 226 DPSLVAGFTIRYGNSGSKLIDMSVKKQLEEIAAELDLGDIQ 266 >ref|XP_012453807.1| PREDICTED: ATP synthase subunit delta, chloroplastic [Gossypium raimondii] gi|763745364|gb|KJB12803.1| hypothetical protein B456_002G037600 [Gossypium raimondii] Length = 240 Score = 77.0 bits (188), Expect = 5e-12 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFT+RYG+SGSKLID+SVKKQLEEIAAQLDLGDI+ Sbjct: 197 DPSLVAGFTIRYGSSGSKLIDMSVKKQLEEIAAQLDLGDIQ 237 >ref|XP_011038195.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Populus euphratica] Length = 250 Score = 77.0 bits (188), Expect = 5e-12 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVRYGNSGSKLID+SVKKQLEEIAAQLDL DI+ Sbjct: 207 DPSLVAGFTVRYGNSGSKLIDMSVKKQLEEIAAQLDLSDIE 247 >ref|XP_006376336.1| hypothetical protein POPTR_0013s12130g [Populus trichocarpa] gi|550325612|gb|ERP54133.1| hypothetical protein POPTR_0013s12130g [Populus trichocarpa] Length = 250 Score = 77.0 bits (188), Expect = 5e-12 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVRYGNSGSKLID+SVKKQLEEIAAQLDL DI+ Sbjct: 207 DPSLVAGFTVRYGNSGSKLIDMSVKKQLEEIAAQLDLSDIE 247 >ref|XP_008463069.1| PREDICTED: ATP synthase delta chain, chloroplastic [Cucumis melo] Length = 240 Score = 76.6 bits (187), Expect = 7e-12 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVR+GNSGSKLIDLSVKKQLEEIAAQLDLG+I+ Sbjct: 197 DPSLVAGFTVRFGNSGSKLIDLSVKKQLEEIAAQLDLGNIQ 237 >ref|XP_004138373.1| PREDICTED: ATP synthase subunit delta, chloroplastic [Cucumis sativus] gi|700190676|gb|KGN45880.1| hypothetical protein Csa_6G016970 [Cucumis sativus] Length = 240 Score = 76.6 bits (187), Expect = 7e-12 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVR+GNSGSKLIDLSVKKQLEEIAAQLDLG+I+ Sbjct: 197 DPSLVAGFTVRFGNSGSKLIDLSVKKQLEEIAAQLDLGNIQ 237 >ref|XP_003608818.1| F0F1-type ATP synthase, delta subunit [Medicago truncatula] gi|355509873|gb|AES91015.1| F0F1-type ATP synthase, delta subunit [Medicago truncatula] Length = 249 Score = 76.6 bits (187), Expect = 7e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVRYGNSGSK ID+SVKK+LEEIA+QLDLGDIK Sbjct: 206 DPSLVAGFTVRYGNSGSKFIDMSVKKKLEEIASQLDLGDIK 246 >ref|XP_010530142.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Tarenaya hassleriana] Length = 234 Score = 76.3 bits (186), Expect = 9e-12 Identities = 36/41 (87%), Positives = 40/41 (97%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DP LVAGFT+RYGNSGSKLID+SVKKQLE+IAAQLDLGDI+ Sbjct: 191 DPELVAGFTIRYGNSGSKLIDMSVKKQLEDIAAQLDLGDIQ 231 >gb|EPS71748.1| hypothetical protein M569_03009, partial [Genlisea aurea] Length = 190 Score = 76.3 bits (186), Expect = 9e-12 Identities = 36/41 (87%), Positives = 41/41 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFT+RYGN+GSKLIDLSVKKQLEEIAAQL++GDI+ Sbjct: 148 DPSLVAGFTIRYGNTGSKLIDLSVKKQLEEIAAQLEIGDIQ 188 >ref|XP_010094830.1| ATP synthase delta chain [Morus notabilis] gi|587867986|gb|EXB57359.1| ATP synthase delta chain [Morus notabilis] Length = 247 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDI 167 DPSLVAGFTVR+G++GSKLIDLSVKKQLEEIAAQLDLGDI Sbjct: 204 DPSLVAGFTVRFGSTGSKLIDLSVKKQLEEIAAQLDLGDI 243 >ref|XP_008358508.1| PREDICTED: ATP synthase delta chain, chloroplastic-like [Malus domestica] Length = 149 Score = 75.1 bits (183), Expect = 2e-11 Identities = 38/41 (92%), Positives = 39/41 (95%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 D SLVAGFTVRYG SGSKLIDLSVKKQLEEIAA+LDLGDIK Sbjct: 106 DSSLVAGFTVRYGQSGSKLIDLSVKKQLEEIAAELDLGDIK 146 >ref|XP_012089674.1| PREDICTED: ATP synthase subunit delta, chloroplastic [Jatropha curcas] gi|643707105|gb|KDP22880.1| hypothetical protein JCGZ_01954 [Jatropha curcas] Length = 248 Score = 75.1 bits (183), Expect = 2e-11 Identities = 37/41 (90%), Positives = 41/41 (100%) Frame = -3 Query: 286 DPSLVAGFTVRYGNSGSKLIDLSVKKQLEEIAAQLDLGDIK 164 DPSLVAGFTVR+G+SGSKLIDLSVKKQLEEIAAQL+LGDI+ Sbjct: 206 DPSLVAGFTVRFGSSGSKLIDLSVKKQLEEIAAQLELGDIQ 246