BLASTX nr result
ID: Ziziphus21_contig00002867
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00002867 (203 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010105438.1| hypothetical protein L484_009906 [Morus nota... 65 3e-08 >ref|XP_010105438.1| hypothetical protein L484_009906 [Morus notabilis] gi|587917116|gb|EXC04713.1| hypothetical protein L484_009906 [Morus notabilis] Length = 255 Score = 64.7 bits (156), Expect = 3e-08 Identities = 39/79 (49%), Positives = 45/79 (56%), Gaps = 15/79 (18%) Frame = +1 Query: 1 SIPKVSQVRPFFGATGTRKLAKEKGWSFCLSVADSDRLTTETSDKSSGNAEIPL------ 162 SI K QV+ FGA+G+R+L K K W F LSVA+ DR T ETSD SGNAE L Sbjct: 30 SISKACQVKSSFGASGSRRLVKGKRWDFSLSVAEGDRFTAETSDGGSGNAERLLSNDQIS 89 Query: 163 ---------SAENSRVQIS 192 S ENS+VQ S Sbjct: 90 TSNLPSSLYSIENSQVQTS 108