BLASTX nr result
ID: Ziziphus21_contig00002827
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00002827 (723 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006472271.1| PREDICTED: keratin, type II cytoskeletal 2 e... 62 5e-07 ref|XP_006472270.1| PREDICTED: keratin, type II cytoskeletal 2 e... 62 5e-07 ref|XP_006433604.1| hypothetical protein CICLE_v10002844mg [Citr... 58 5e-06 ref|XP_006433603.1| hypothetical protein CICLE_v10002844mg [Citr... 58 5e-06 >ref|XP_006472271.1| PREDICTED: keratin, type II cytoskeletal 2 epidermal-like isoform X2 [Citrus sinensis] Length = 94 Score = 61.6 bits (148), Expect = 5e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = -1 Query: 390 AFGSQYRSSRVTFQGVEFGRKEHDDGGKMRGLQKNTQEVRASQ 262 AFGSQYRSSRVTFQG EFGRK+ +D +++ ++++TQ+VRASQ Sbjct: 52 AFGSQYRSSRVTFQGTEFGRKDKNDRKEVKDIRESTQKVRASQ 94 >ref|XP_006472270.1| PREDICTED: keratin, type II cytoskeletal 2 epidermal-like isoform X1 [Citrus sinensis] gi|641862878|gb|KDO81565.1| hypothetical protein CISIN_1g034322mg [Citrus sinensis] Length = 98 Score = 61.6 bits (148), Expect = 5e-07 Identities = 28/43 (65%), Positives = 38/43 (88%) Frame = -1 Query: 390 AFGSQYRSSRVTFQGVEFGRKEHDDGGKMRGLQKNTQEVRASQ 262 AFGSQYRSSRVTFQG EFGRK+ +D +++ ++++TQ+VRASQ Sbjct: 56 AFGSQYRSSRVTFQGTEFGRKDKNDRKEVKDIRESTQKVRASQ 98 >ref|XP_006433604.1| hypothetical protein CICLE_v10002844mg [Citrus clementina] gi|557535726|gb|ESR46844.1| hypothetical protein CICLE_v10002844mg [Citrus clementina] Length = 126 Score = 58.2 bits (139), Expect = 5e-06 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = -1 Query: 390 AFGSQYRSSRVTFQGVEFGRKEHDDGGKMRGLQKNTQEVRASQ 262 AFGSQYRSSRVTFQG EF RK+ +D +++ ++++TQ+VRASQ Sbjct: 84 AFGSQYRSSRVTFQGTEFVRKDKNDRKEVKDIRESTQKVRASQ 126 >ref|XP_006433603.1| hypothetical protein CICLE_v10002844mg [Citrus clementina] gi|557535725|gb|ESR46843.1| hypothetical protein CICLE_v10002844mg [Citrus clementina] Length = 98 Score = 58.2 bits (139), Expect = 5e-06 Identities = 27/43 (62%), Positives = 37/43 (86%) Frame = -1 Query: 390 AFGSQYRSSRVTFQGVEFGRKEHDDGGKMRGLQKNTQEVRASQ 262 AFGSQYRSSRVTFQG EF RK+ +D +++ ++++TQ+VRASQ Sbjct: 56 AFGSQYRSSRVTFQGTEFVRKDKNDRKEVKDIRESTQKVRASQ 98