BLASTX nr result
ID: Ziziphus21_contig00002585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00002585 (270 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010098081.1| 30S ribosomal protein S17 [Morus notabilis] ... 78 3e-12 ref|XP_007024188.1| Ribosomal protein S17 [Theobroma cacao] gi|5... 75 3e-11 ref|XP_008462167.1| PREDICTED: 30S ribosomal protein S17, chloro... 74 3e-11 ref|XP_009778216.1| PREDICTED: 30S ribosomal protein S17, chloro... 74 6e-11 ref|XP_009592771.1| PREDICTED: 30S ribosomal protein S17, chloro... 74 6e-11 ref|XP_004141765.1| PREDICTED: 30S ribosomal protein S17, chloro... 73 7e-11 ref|XP_010254084.1| PREDICTED: 30S ribosomal protein S17, chloro... 71 3e-10 ref|XP_006343079.1| PREDICTED: 30S ribosomal protein S17, chloro... 71 4e-10 ref|XP_012442970.1| PREDICTED: 30S ribosomal protein S17, chloro... 70 5e-10 ref|XP_010431660.1| PREDICTED: 30S ribosomal protein S17, chloro... 69 1e-09 ref|XP_006301046.1| hypothetical protein CARUB_v10021438mg [Caps... 69 2e-09 ref|XP_004235675.1| PREDICTED: 30S ribosomal protein S17, chloro... 69 2e-09 ref|XP_010474522.1| PREDICTED: 30S ribosomal protein S17, chloro... 68 2e-09 ref|XP_010473019.1| PREDICTED: 30S ribosomal protein S17, chloro... 68 2e-09 ref|XP_012457667.1| PREDICTED: 30S ribosomal protein S17, chloro... 67 4e-09 ref|XP_011009826.1| PREDICTED: 30S ribosomal protein S17, chloro... 67 5e-09 emb|CBI36128.3| unnamed protein product [Vitis vinifera] 67 5e-09 ref|XP_002284468.1| PREDICTED: 30S ribosomal protein S17, chloro... 67 5e-09 ref|NP_178103.1| 30S ribosomal protein S17 [Arabidopsis thaliana... 66 9e-09 emb|CDO98023.1| unnamed protein product [Coffea canephora] 66 9e-09 >ref|XP_010098081.1| 30S ribosomal protein S17 [Morus notabilis] gi|587885661|gb|EXB74518.1| 30S ribosomal protein S17 [Morus notabilis] Length = 167 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GS PLS LSKP+S + +P S PP+FLP IRAMRSLQG+VVCAT+DKTVAVE Sbjct: 35 GSIPLSLLSKPSSSLTNPTSCPPNFLPPIRAMRSLQGRVVCATSDKTVAVE 85 >ref|XP_007024188.1| Ribosomal protein S17 [Theobroma cacao] gi|508779554|gb|EOY26810.1| Ribosomal protein S17 [Theobroma cacao] Length = 152 Score = 74.7 bits (182), Expect = 3e-11 Identities = 37/51 (72%), Positives = 42/51 (82%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GST LS LSKPNS + H K P+FLP IRA++SLQGKVVCATNDKTV+VE Sbjct: 19 GSTSLSLLSKPNSSLSHQPLKTPTFLPPIRALKSLQGKVVCATNDKTVSVE 69 >ref|XP_008462167.1| PREDICTED: 30S ribosomal protein S17, chloroplastic [Cucumis melo] Length = 164 Score = 74.3 bits (181), Expect = 3e-11 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GSTPLS LSKP+S S+ P+FLP+IRAMRSLQG+VVCATNDKTVAVE Sbjct: 31 GSTPLSFLSKPSSSPSPLASQTPNFLPSIRAMRSLQGRVVCATNDKTVAVE 81 >ref|XP_009778216.1| PREDICTED: 30S ribosomal protein S17, chloroplastic [Nicotiana sylvestris] Length = 158 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GS+ LS+LSKP+S + P PP+FLP IRAMRS+QG+VVC+TNDKTV+VE Sbjct: 27 GSSSLSRLSKPSSSITSPNPSPPAFLPPIRAMRSMQGRVVCSTNDKTVSVE 77 >ref|XP_009592771.1| PREDICTED: 30S ribosomal protein S17, chloroplastic [Nicotiana tomentosiformis] Length = 158 Score = 73.6 bits (179), Expect = 6e-11 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GS+ LS+LSKP+S + P PP+FLP IRAMRS+QG+VVC+TNDKTV+VE Sbjct: 27 GSSSLSRLSKPSSSITSPNPSPPAFLPPIRAMRSMQGRVVCSTNDKTVSVE 77 >ref|XP_004141765.1| PREDICTED: 30S ribosomal protein S17, chloroplastic [Cucumis sativus] gi|700190151|gb|KGN45384.1| hypothetical protein Csa_7G446990 [Cucumis sativus] Length = 164 Score = 73.2 bits (178), Expect = 7e-11 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GSTPLS LSKP+S S+ P+FLP+IRAMRSLQG+VVCATNDKTVAVE Sbjct: 31 GSTPLSFLSKPSSSSSPFPSQTPNFLPSIRAMRSLQGRVVCATNDKTVAVE 81 >ref|XP_010254084.1| PREDICTED: 30S ribosomal protein S17, chloroplastic [Nelumbo nucifera] Length = 157 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GSTP+ L+KP+S + PPSFLP IRAM+SLQG+VVCATNDKTVAVE Sbjct: 27 GSTPVRLLNKPSSSLSPSNPSPPSFLPPIRAMKSLQGRVVCATNDKTVAVE 77 >ref|XP_006343079.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Solanum tuberosum] Length = 153 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/51 (64%), Positives = 42/51 (82%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GS+ LS+LSKP+S + PP+FLP IRAMRS+QG+VVC+TNDKTV+VE Sbjct: 23 GSSSLSRLSKPSSSITSQKPSPPAFLPPIRAMRSMQGRVVCSTNDKTVSVE 73 >ref|XP_012442970.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Gossypium raimondii] gi|763789764|gb|KJB56760.1| hypothetical protein B456_009G135000 [Gossypium raimondii] Length = 153 Score = 70.5 bits (171), Expect = 5e-10 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GST L LSKPNS H + P+FLP IRAM+S+QG+VVCATNDKTVAVE Sbjct: 19 GSTSLPLLSKPNSSPPHQPLRSPAFLPPIRAMKSMQGRVVCATNDKTVAVE 69 >ref|XP_010431660.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like, partial [Camelina sativa] gi|727510748|ref|XP_010431662.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like, partial [Camelina sativa] Length = 173 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GSTPLS LSKPNS P K P+ +P IRAM+++QG+VVCATNDKTVAVE Sbjct: 49 GSTPLSSLSKPNS---FPNPKMPALVPVIRAMKTMQGRVVCATNDKTVAVE 96 >ref|XP_006301046.1| hypothetical protein CARUB_v10021438mg [Capsella rubella] gi|482569756|gb|EOA33944.1| hypothetical protein CARUB_v10021438mg [Capsella rubella] Length = 144 Score = 68.6 bits (166), Expect = 2e-09 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GSTPLS LSKPNS P + P+ +P IRAM+++QG+VVCATNDKTVAVE Sbjct: 20 GSTPLSSLSKPNS---FPSPRMPALVPVIRAMKTMQGRVVCATNDKTVAVE 67 >ref|XP_004235675.1| PREDICTED: 30S ribosomal protein S17, chloroplastic [Solanum lycopersicum] Length = 153 Score = 68.6 bits (166), Expect = 2e-09 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GS+ LS+LS P+S + PP+FLP IRAMRS+QG+VVC+TNDKTV+VE Sbjct: 23 GSSSLSRLSTPSSSITSQKPSPPAFLPPIRAMRSMQGRVVCSTNDKTVSVE 73 >ref|XP_010474522.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Camelina sativa] Length = 101 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GSTPLS LSKPNS P + P+ +P IRAM+++QG+VVCATNDKTVAVE Sbjct: 20 GSTPLSSLSKPNS---FPNPRMPALVPVIRAMKTMQGRVVCATNDKTVAVE 67 >ref|XP_010473019.1| PREDICTED: 30S ribosomal protein S17, chloroplastic [Camelina sativa] Length = 147 Score = 68.2 bits (165), Expect = 2e-09 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GSTPLS LSKPNS P + P+ +P IRAM+++QG+VVCATNDKTVAVE Sbjct: 20 GSTPLSSLSKPNS---FPNPRMPALVPVIRAMKTMQGRVVCATNDKTVAVE 67 >ref|XP_012457667.1| PREDICTED: 30S ribosomal protein S17, chloroplastic-like [Gossypium raimondii] gi|763802403|gb|KJB69341.1| hypothetical protein B456_011G074400 [Gossypium raimondii] Length = 148 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/50 (68%), Positives = 40/50 (80%) Frame = -3 Query: 151 STPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 ST L +LSKPNS + K P+FLP IRAM+S+QGKVVCATNDKTV+VE Sbjct: 21 STSLYRLSKPNSSLSCQPLKSPAFLPPIRAMKSMQGKVVCATNDKTVSVE 70 >ref|XP_011009826.1| PREDICTED: 30S ribosomal protein S17, chloroplastic [Populus euphratica] gi|743931132|ref|XP_011009827.1| PREDICTED: 30S ribosomal protein S17, chloroplastic [Populus euphratica] Length = 200 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/51 (66%), Positives = 41/51 (80%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 G+T LS LSKP S + +KP +FLP IRAM+S+QGKVVCAT+DKTVAVE Sbjct: 63 GTTQLSHLSKPTSSLSLRPTKPFTFLPPIRAMKSMQGKVVCATSDKTVAVE 113 >emb|CBI36128.3| unnamed protein product [Vitis vinifera] Length = 189 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GS+ LS LSKP+S + PP+FLP IRAM+S+QG+VVCAT+DKTVAVE Sbjct: 60 GSSNLSLLSKPSSTSLASPPPPPTFLPPIRAMKSMQGRVVCATSDKTVAVE 110 >ref|XP_002284468.1| PREDICTED: 30S ribosomal protein S17, chloroplastic [Vitis vinifera] Length = 145 Score = 67.0 bits (162), Expect = 5e-09 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GS+ LS LSKP+S + PP+FLP IRAM+S+QG+VVCAT+DKTVAVE Sbjct: 16 GSSNLSLLSKPSSTSLASPPPPPTFLPPIRAMKSMQGRVVCATSDKTVAVE 66 >ref|NP_178103.1| 30S ribosomal protein S17 [Arabidopsis thaliana] gi|133815|sp|P16180.1|RR17_ARATH RecName: Full=30S ribosomal protein S17, chloroplastic; AltName: Full=CS17; Flags: Precursor gi|12324576|gb|AAG52237.1|AC011717_5 30S ribosomal protein S17, chloroplast precursor (CS17); 62258-62707 [Arabidopsis thaliana] gi|14423474|gb|AAK62419.1|AF386974_1 30S ribosomal protein S17, chloroplast precursor (CS17) [Arabidopsis thaliana] gi|16503|emb|CAA77502.1| Plastid ribosomal protein CS17 [Arabidopsis thaliana] gi|18377576|gb|AAL66954.1| 30S ribosomal protein S17, chloroplast precursor (CS17) [Arabidopsis thaliana] gi|332198192|gb|AEE36313.1| 30S ribosomal protein S17 [Arabidopsis thaliana] Length = 149 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/51 (64%), Positives = 41/51 (80%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GSTPLS LSKPNS P + P+ +P IRAM+++QG+VVCAT+DKTVAVE Sbjct: 22 GSTPLSSLSKPNS---FPNHRMPALVPVIRAMKTMQGRVVCATSDKTVAVE 69 >emb|CDO98023.1| unnamed protein product [Coffea canephora] Length = 165 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/51 (62%), Positives = 42/51 (82%) Frame = -3 Query: 154 GSTPLSQLSKPNSCVIHPVSKPPSFLPTIRAMRSLQGKVVCATNDKTVAVE 2 GSTP+S LSKP+S + + + P + LP IRAM+S+QG+VVCAT+DKTVAVE Sbjct: 27 GSTPISLLSKPSSSLSNARTSPLTVLPPIRAMKSMQGRVVCATSDKTVAVE 77