BLASTX nr result
ID: Ziziphus21_contig00001716
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Ziziphus21_contig00001716 (649 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KNA23099.1| hypothetical protein SOVF_027910 [Spinacia oleracea] 146 9e-33 ref|XP_009587880.1| PREDICTED: WPP domain-associated protein-lik... 143 7e-32 ref|XP_010687082.1| PREDICTED: WPP domain-associated protein [Be... 143 1e-31 ref|XP_009800226.1| PREDICTED: WPP domain-associated protein [Ni... 143 1e-31 emb|CBI31022.3| unnamed protein product [Vitis vinifera] 143 1e-31 ref|XP_002264075.1| PREDICTED: WPP domain-associated protein [Vi... 143 1e-31 ref|XP_012075755.1| PREDICTED: WPP domain-associated protein-lik... 140 5e-31 ref|XP_002523187.1| Early endosome antigen, putative [Ricinus co... 139 1e-30 ref|XP_010316952.1| PREDICTED: WPP domain-associated protein [So... 139 1e-30 ref|XP_006353010.1| PREDICTED: WPP domain-associated protein-lik... 139 2e-30 gb|KDO75245.1| hypothetical protein CISIN_1g002225mg [Citrus sin... 135 3e-29 ref|XP_006468318.1| PREDICTED: WPP domain-associated protein-lik... 135 3e-29 ref|XP_007022891.1| Early endosome antigen, putative isoform 1 [... 133 1e-28 ref|XP_009598621.1| PREDICTED: WPP domain-associated protein-lik... 132 1e-28 ref|XP_010056982.1| PREDICTED: WPP domain-associated protein-lik... 132 2e-28 ref|XP_010247766.1| PREDICTED: WPP domain-associated protein [Ne... 131 3e-28 emb|CDP17300.1| unnamed protein product [Coffea canephora] 131 3e-28 ref|XP_008364287.1| PREDICTED: WPP domain-associated protein-lik... 131 3e-28 ref|XP_008225599.1| PREDICTED: WPP domain-associated protein [Pr... 131 3e-28 ref|XP_004134899.1| PREDICTED: WPP domain-associated protein [Cu... 131 4e-28 >gb|KNA23099.1| hypothetical protein SOVF_027910 [Spinacia oleracea] Length = 844 Score = 146 bits (369), Expect = 9e-33 Identities = 70/86 (81%), Positives = 80/86 (93%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 LI K N+LRRTG LYK+RLD+KCSDLQKAEAEVDLLGD+VD LSSLLEKIY+ALDHYSPI Sbjct: 759 LIPKVNVLRRTGFLYKERLDKKCSDLQKAEAEVDLLGDEVDTLSSLLEKIYVALDHYSPI 818 Query: 464 LQHYPGIVEILKLVKRELSGESTRSV 387 LQHYPGI+EILKLVKRELS E+ +++ Sbjct: 819 LQHYPGIIEILKLVKRELSEEAVKTI 844 >ref|XP_009587880.1| PREDICTED: WPP domain-associated protein-like [Nicotiana tomentosiformis] Length = 898 Score = 143 bits (361), Expect = 7e-32 Identities = 70/89 (78%), Positives = 83/89 (93%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 L++KAN+LRRT LLY+QRLDR+CSDLQ AEAEVDLLGD+VD L SLLEKIYIALDHYSP+ Sbjct: 808 LVKKANLLRRTILLYQQRLDRRCSDLQLAEAEVDLLGDEVDTLLSLLEKIYIALDHYSPV 867 Query: 464 LQHYPGIVEILKLVKRELSGESTRSV*SA 378 LQHYPGI+EILK++KREL+GEST+ V S+ Sbjct: 868 LQHYPGIIEILKVIKRELTGESTKLVKSS 896 >ref|XP_010687082.1| PREDICTED: WPP domain-associated protein [Beta vulgaris subsp. vulgaris] gi|870851939|gb|KMT03917.1| hypothetical protein BVRB_8g187750 [Beta vulgaris subsp. vulgaris] Length = 855 Score = 143 bits (360), Expect = 1e-31 Identities = 70/86 (81%), Positives = 80/86 (93%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 LI K N+LRRTG LYK+RL++KCSDL+KAEAEVDLLGD+VDAL SLLEKIY+ALDHYSPI Sbjct: 770 LIPKLNVLRRTGSLYKERLEKKCSDLEKAEAEVDLLGDEVDALLSLLEKIYVALDHYSPI 829 Query: 464 LQHYPGIVEILKLVKRELSGESTRSV 387 LQHYPGI+EILKLVKRELS E+ R+V Sbjct: 830 LQHYPGIIEILKLVKRELSVEANRAV 855 >ref|XP_009800226.1| PREDICTED: WPP domain-associated protein [Nicotiana sylvestris] Length = 898 Score = 143 bits (360), Expect = 1e-31 Identities = 70/89 (78%), Positives = 83/89 (93%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 L++KAN+LRRT LLY+QRLDR+CSDLQ AEAEVDLLGD+VD L SLLEKIYIALDHYSP+ Sbjct: 808 LVKKANLLRRTMLLYQQRLDRRCSDLQLAEAEVDLLGDEVDTLLSLLEKIYIALDHYSPV 867 Query: 464 LQHYPGIVEILKLVKRELSGESTRSV*SA 378 LQHYPGI+EILK++KREL+GEST+ V S+ Sbjct: 868 LQHYPGIMEILKVIKRELTGESTKLVKSS 896 >emb|CBI31022.3| unnamed protein product [Vitis vinifera] Length = 807 Score = 143 bits (360), Expect = 1e-31 Identities = 72/86 (83%), Positives = 79/86 (91%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 LIQKANILRRT L YKQRL+R+ SDLQKAE EVDLLGD+VDAL SLLEKIYIALDHYSPI Sbjct: 722 LIQKANILRRTSLRYKQRLERRYSDLQKAETEVDLLGDEVDALLSLLEKIYIALDHYSPI 781 Query: 464 LQHYPGIVEILKLVKRELSGESTRSV 387 LQHYPG++EILKLV+RELS EST+ V Sbjct: 782 LQHYPGVIEILKLVRRELSAESTKPV 807 >ref|XP_002264075.1| PREDICTED: WPP domain-associated protein [Vitis vinifera] gi|731405355|ref|XP_010655749.1| PREDICTED: WPP domain-associated protein [Vitis vinifera] gi|731405357|ref|XP_010655750.1| PREDICTED: WPP domain-associated protein [Vitis vinifera] gi|731405359|ref|XP_010655751.1| PREDICTED: WPP domain-associated protein [Vitis vinifera] Length = 902 Score = 143 bits (360), Expect = 1e-31 Identities = 72/86 (83%), Positives = 79/86 (91%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 LIQKANILRRT L YKQRL+R+ SDLQKAE EVDLLGD+VDAL SLLEKIYIALDHYSPI Sbjct: 817 LIQKANILRRTSLRYKQRLERRYSDLQKAETEVDLLGDEVDALLSLLEKIYIALDHYSPI 876 Query: 464 LQHYPGIVEILKLVKRELSGESTRSV 387 LQHYPG++EILKLV+RELS EST+ V Sbjct: 877 LQHYPGVIEILKLVRRELSAESTKPV 902 >ref|XP_012075755.1| PREDICTED: WPP domain-associated protein-like [Jatropha curcas] Length = 819 Score = 140 bits (354), Expect = 5e-31 Identities = 70/84 (83%), Positives = 77/84 (91%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 LIQKAN L+R LYKQRL+R+CSDLQKAEAEVDLLGDKVD L SLLEKIYIALDHYSPI Sbjct: 734 LIQKANALKREEFLYKQRLERRCSDLQKAEAEVDLLGDKVDTLLSLLEKIYIALDHYSPI 793 Query: 464 LQHYPGIVEILKLVKRELSGESTR 393 L+HYPGI+EILKLV+RELSGES + Sbjct: 794 LKHYPGIMEILKLVRRELSGESVK 817 >ref|XP_002523187.1| Early endosome antigen, putative [Ricinus communis] gi|223537594|gb|EEF39218.1| Early endosome antigen, putative [Ricinus communis] Length = 903 Score = 139 bits (351), Expect = 1e-30 Identities = 68/86 (79%), Positives = 79/86 (91%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 L+Q AN LRRTGL+YKQ+L+ +CSDL+KAEAEVDLLGD+VD L SLLEKIYIALDHYSPI Sbjct: 818 LVQDANKLRRTGLMYKQKLEVRCSDLRKAEAEVDLLGDEVDTLLSLLEKIYIALDHYSPI 877 Query: 464 LQHYPGIVEILKLVKRELSGESTRSV 387 LQHYPGI+E+LKLV+RELSGES + V Sbjct: 878 LQHYPGIMEVLKLVRRELSGESVKPV 903 >ref|XP_010316952.1| PREDICTED: WPP domain-associated protein [Solanum lycopersicum] Length = 897 Score = 139 bits (350), Expect = 1e-30 Identities = 67/89 (75%), Positives = 83/89 (93%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 L++KAN+LRRT LLY+QRL+++CSDL+ AEAEVDLLGD+VD L SL+EKIYIALDHYSP+ Sbjct: 807 LVKKANLLRRTTLLYQQRLEKRCSDLKLAEAEVDLLGDEVDTLLSLVEKIYIALDHYSPV 866 Query: 464 LQHYPGIVEILKLVKRELSGESTRSV*SA 378 LQHYPGI+EILKL+KREL+GEST+ V S+ Sbjct: 867 LQHYPGIMEILKLIKRELTGESTKLVKSS 895 >ref|XP_006353010.1| PREDICTED: WPP domain-associated protein-like [Solanum tuberosum] Length = 902 Score = 139 bits (349), Expect = 2e-30 Identities = 67/89 (75%), Positives = 83/89 (93%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 L++KAN+LRRT LLY+QRL+++CSDL+ AEAEVDLLGD+VD L SL+EKIYIALDHYSP+ Sbjct: 812 LVKKANLLRRTTLLYQQRLEKRCSDLKLAEAEVDLLGDEVDILLSLVEKIYIALDHYSPV 871 Query: 464 LQHYPGIVEILKLVKRELSGESTRSV*SA 378 LQHYPGI+EILKL+KREL+GEST+ V S+ Sbjct: 872 LQHYPGIMEILKLIKRELTGESTKLVKSS 900 >gb|KDO75245.1| hypothetical protein CISIN_1g002225mg [Citrus sinensis] gi|641856480|gb|KDO75246.1| hypothetical protein CISIN_1g002225mg [Citrus sinensis] gi|641856481|gb|KDO75247.1| hypothetical protein CISIN_1g002225mg [Citrus sinensis] Length = 936 Score = 135 bits (339), Expect = 3e-29 Identities = 65/81 (80%), Positives = 75/81 (92%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 LI KAN++ RTGL YKQ+L+R+CSDLQKAEAEVDLLGD+VD LS LLEKIYIALDHYS + Sbjct: 851 LILKANVITRTGLSYKQKLERRCSDLQKAEAEVDLLGDEVDTLSGLLEKIYIALDHYSSV 910 Query: 464 LQHYPGIVEILKLVKRELSGE 402 LQHYPGI+EIL+LV+RELSGE Sbjct: 911 LQHYPGIMEILRLVRRELSGE 931 >ref|XP_006468318.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Citrus sinensis] Length = 936 Score = 135 bits (339), Expect = 3e-29 Identities = 65/81 (80%), Positives = 75/81 (92%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 LI KAN++ RTGL YKQ+L+R+CSDLQKAEAEVDLLGD+VD LS LLEKIYIALDHYS + Sbjct: 851 LILKANVITRTGLSYKQKLERRCSDLQKAEAEVDLLGDEVDTLSGLLEKIYIALDHYSSV 910 Query: 464 LQHYPGIVEILKLVKRELSGE 402 LQHYPGI+EIL+LV+RELSGE Sbjct: 911 LQHYPGIMEILRLVRRELSGE 931 >ref|XP_007022891.1| Early endosome antigen, putative isoform 1 [Theobroma cacao] gi|508778257|gb|EOY25513.1| Early endosome antigen, putative isoform 1 [Theobroma cacao] Length = 882 Score = 133 bits (334), Expect = 1e-28 Identities = 65/86 (75%), Positives = 75/86 (87%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 LIQ AN+L+R GL YKQ L+R+CSDL+KAE EVDLLGD+VD L LLEKIYIALDHYSPI Sbjct: 797 LIQMANVLKRKGLHYKQNLERRCSDLEKAETEVDLLGDQVDVLLGLLEKIYIALDHYSPI 856 Query: 464 LQHYPGIVEILKLVKRELSGESTRSV 387 L+HY G++EIL LV+RELSGESTR V Sbjct: 857 LKHYTGVMEILNLVRRELSGESTRPV 882 >ref|XP_009598621.1| PREDICTED: WPP domain-associated protein-like [Nicotiana tomentosiformis] Length = 924 Score = 132 bits (333), Expect = 1e-28 Identities = 63/86 (73%), Positives = 76/86 (88%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 L +K N LRRT LLY+QRL+++CSDLQKAEAEVDLLGD+VD L LLEKIYIALDHYSP+ Sbjct: 838 LAKKTNSLRRTVLLYRQRLEKRCSDLQKAEAEVDLLGDEVDTLLRLLEKIYIALDHYSPV 897 Query: 464 LQHYPGIVEILKLVKRELSGESTRSV 387 LQHYPGI+EILKL+++EL G+S + V Sbjct: 898 LQHYPGIIEILKLIRKELRGDSAKPV 923 >ref|XP_010056982.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Eucalyptus grandis] gi|702345207|ref|XP_010056983.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Eucalyptus grandis] gi|702345212|ref|XP_010056984.1| PREDICTED: WPP domain-associated protein-like isoform X1 [Eucalyptus grandis] gi|629108772|gb|KCW73918.1| hypothetical protein EUGRSUZ_E02503 [Eucalyptus grandis] gi|629108773|gb|KCW73919.1| hypothetical protein EUGRSUZ_E02503 [Eucalyptus grandis] Length = 897 Score = 132 bits (332), Expect = 2e-28 Identities = 63/84 (75%), Positives = 75/84 (89%) Frame = -3 Query: 638 QKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPILQ 459 QKA LRR G +Y+QRL+RKCSDLQKAEAEVDLLGD+VD L +LLEK+YI LDHYSPILQ Sbjct: 814 QKAIALRRMGYIYEQRLERKCSDLQKAEAEVDLLGDQVDTLLNLLEKVYIGLDHYSPILQ 873 Query: 458 HYPGIVEILKLVKRELSGESTRSV 387 HYPGI+E+LKLV+REL+GES + + Sbjct: 874 HYPGIMEVLKLVRRELTGESLKLI 897 >ref|XP_010247766.1| PREDICTED: WPP domain-associated protein [Nelumbo nucifera] gi|720098870|ref|XP_010247767.1| PREDICTED: WPP domain-associated protein [Nelumbo nucifera] Length = 851 Score = 131 bits (330), Expect = 3e-28 Identities = 64/82 (78%), Positives = 75/82 (91%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 L+Q AN LRR GL+Y+QRL+R+CSDLQ AEAEVDLLGD+VDAL SLLEKIYIALDHY+P+ Sbjct: 767 LVQGANSLRRIGLMYEQRLERRCSDLQMAEAEVDLLGDQVDALLSLLEKIYIALDHYAPV 826 Query: 464 LQHYPGIVEILKLVKRELSGES 399 LQHY GI+EILKLV+REL GE+ Sbjct: 827 LQHYTGIMEILKLVRRELRGET 848 >emb|CDP17300.1| unnamed protein product [Coffea canephora] Length = 876 Score = 131 bits (330), Expect = 3e-28 Identities = 60/84 (71%), Positives = 77/84 (91%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 L++KAN+L+RTG +Y+QRL+RKC+ LQKAEAEVDLLGDKVD L +LLEKIYI LDHYSP+ Sbjct: 786 LVKKANLLKRTGRVYQQRLERKCAHLQKAEAEVDLLGDKVDKLLNLLEKIYIGLDHYSPV 845 Query: 464 LQHYPGIVEILKLVKRELSGESTR 393 L+HYPG++E LKL++REL+GES + Sbjct: 846 LRHYPGVMETLKLIRRELTGESMK 869 >ref|XP_008364287.1| PREDICTED: WPP domain-associated protein-like [Malus domestica] gi|658057049|ref|XP_008364288.1| PREDICTED: WPP domain-associated protein-like [Malus domestica] Length = 873 Score = 131 bits (330), Expect = 3e-28 Identities = 62/83 (74%), Positives = 77/83 (92%) Frame = -3 Query: 647 FLIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSP 468 FL QKAN++ R GLLY+QRL++KCSDL+KAEAEVDLLGDKV+ L SL+EKI+IALDHYSP Sbjct: 788 FLKQKANVIVRRGLLYQQRLEKKCSDLEKAEAEVDLLGDKVETLLSLVEKIHIALDHYSP 847 Query: 467 ILQHYPGIVEILKLVKRELSGES 399 +L+HYPGI EILKL++REL+GE+ Sbjct: 848 VLKHYPGITEILKLLRRELTGET 870 >ref|XP_008225599.1| PREDICTED: WPP domain-associated protein [Prunus mume] gi|645238272|ref|XP_008225600.1| PREDICTED: WPP domain-associated protein [Prunus mume] gi|645238274|ref|XP_008225601.1| PREDICTED: WPP domain-associated protein [Prunus mume] Length = 911 Score = 131 bits (330), Expect = 3e-28 Identities = 64/82 (78%), Positives = 73/82 (89%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 L +KAN+L R G LYKQR +RKCSDL+KAEAEVDLLGD+VD L SL+EKIYIALDHYSPI Sbjct: 827 LKEKANVLVRRGSLYKQRFERKCSDLEKAEAEVDLLGDEVDTLLSLVEKIYIALDHYSPI 886 Query: 464 LQHYPGIVEILKLVKRELSGES 399 LQHYPGI E+LKLV+REL GE+ Sbjct: 887 LQHYPGITEVLKLVRRELRGET 908 >ref|XP_004134899.1| PREDICTED: WPP domain-associated protein [Cucumis sativus] gi|700194262|gb|KGN49466.1| hypothetical protein Csa_6G525510 [Cucumis sativus] Length = 881 Score = 131 bits (329), Expect = 4e-28 Identities = 63/82 (76%), Positives = 76/82 (92%) Frame = -3 Query: 644 LIQKANILRRTGLLYKQRLDRKCSDLQKAEAEVDLLGDKVDALSSLLEKIYIALDHYSPI 465 LIQ A++++R GL+YKQRL+++CSDLQKAEAEVDLLGD+VDAL LLEK+YIALDHYSPI Sbjct: 796 LIQDASMVKRDGLIYKQRLEKRCSDLQKAEAEVDLLGDEVDALLRLLEKMYIALDHYSPI 855 Query: 464 LQHYPGIVEILKLVKRELSGES 399 L+HYPGIVE LKLVKREL G++ Sbjct: 856 LKHYPGIVETLKLVKRELRGDT 877