BLASTX nr result
ID: Zingiber25_contig00047882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00047882 (288 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006488675.1| PREDICTED: cucumisin-like [Citrus sinensis] 99 6e-19 ref|XP_006424938.1| hypothetical protein CICLE_v10030114mg [Citr... 99 6e-19 ref|XP_006488409.1| PREDICTED: cucumisin-like [Citrus sinensis] 97 2e-18 ref|XP_002271624.2| PREDICTED: cucumisin-like [Vitis vinifera] 96 4e-18 emb|CBI24378.3| unnamed protein product [Vitis vinifera] 96 4e-18 emb|CAN62173.1| hypothetical protein VITISV_027754 [Vitis vinifera] 96 4e-18 ref|XP_006424940.1| hypothetical protein CICLE_v10029849mg [Citr... 96 5e-18 ref|XP_002271796.2| PREDICTED: cucumisin-like [Vitis vinifera] 94 1e-17 ref|XP_002314148.2| hypothetical protein POPTR_0009s04280g [Popu... 94 2e-17 ref|XP_006432274.1| hypothetical protein CICLE_v10000577mg [Citr... 91 2e-16 ref|XP_002314147.1| subtilase family protein [Populus trichocarp... 90 3e-16 gb|EOY34208.1| Subtilase family protein, putative [Theobroma cacao] 90 3e-16 ref|XP_006491889.1| PREDICTED: cucumisin-like [Citrus sinensis] 89 5e-16 emb|CBI24380.3| unnamed protein product [Vitis vinifera] 89 5e-16 gb|EMJ21955.1| hypothetical protein PRUPE_ppa024105mg, partial [... 89 6e-16 ref|XP_006280067.1| hypothetical protein CARUB_v10025949mg [Caps... 88 1e-15 ref|XP_006432273.1| hypothetical protein CICLE_v10004018mg [Citr... 87 2e-15 ref|XP_006424943.1| hypothetical protein CICLE_v10029841mg, part... 87 2e-15 dbj|BAB09626.1| subtilisin-like serine protease [Arabidopsis tha... 87 3e-15 ref|XP_006281781.1| hypothetical protein CARUB_v10027951mg [Caps... 87 3e-15 >ref|XP_006488675.1| PREDICTED: cucumisin-like [Citrus sinensis] Length = 1127 Score = 99.0 bits (245), Expect = 6e-19 Identities = 50/93 (53%), Positives = 60/93 (64%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA VQ K F FSRTVTNVG G+ KY AKV+ D ++ + V PS L F L EK Sbjct: 1018 NYPSMAARVQENKPFAVNFSRTVTNVGQGNSKYKAKVTVDPKIKINVAPSDLSFKSLKEK 1077 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + F V+ SG L NS A+L+WSDG + VRS Sbjct: 1078 QSFVVTVSGVGLKENSMVSASLVWSDGTYNVRS 1110 >ref|XP_006424938.1| hypothetical protein CICLE_v10030114mg [Citrus clementina] gi|557526872|gb|ESR38178.1| hypothetical protein CICLE_v10030114mg [Citrus clementina] Length = 711 Score = 99.0 bits (245), Expect = 6e-19 Identities = 50/93 (53%), Positives = 60/93 (64%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA VQ K F FSRTVTNVG G+ KY AKV+ D ++ + V PS L F L EK Sbjct: 602 NYPSMAARVQENKPFAVNFSRTVTNVGQGNSKYKAKVTVDPKIKINVAPSDLSFKSLKEK 661 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + F V+ SG L NS A+L+WSDG + VRS Sbjct: 662 QSFVVTVSGVGLKENSMVSASLVWSDGTYNVRS 694 >ref|XP_006488409.1| PREDICTED: cucumisin-like [Citrus sinensis] Length = 708 Score = 97.1 bits (240), Expect = 2e-18 Identities = 46/93 (49%), Positives = 63/93 (67%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA V SGK+F F RTVTNVG + Y AKV + ++++ V P VL F LNEK Sbjct: 610 NYPSMAAQVSSGKSFVVNFPRTVTNVGVANSTYRAKVLQNSKISIKVVPDVLSFKSLNEK 669 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + F+V+ +G+ +P+ + A+L+WSDG H VRS Sbjct: 670 KSFSVTVTGKGVPQGAIVSASLVWSDGNHWVRS 702 >ref|XP_002271624.2| PREDICTED: cucumisin-like [Vitis vinifera] Length = 744 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/93 (49%), Positives = 59/93 (63%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA K F +F RTVTNVG + Y AK++AD + V VNP+VL F+ LNEK Sbjct: 642 NYPSMASTADQHKPFNIRFPRTVTNVGQANSTYQAKITADPLMKVQVNPNVLSFTSLNEK 701 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + F V+ SG L + A+L+W+DG H VRS Sbjct: 702 KTFVVTVSGEALDKQPNVSASLVWTDGTHSVRS 734 >emb|CBI24378.3| unnamed protein product [Vitis vinifera] Length = 741 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/93 (49%), Positives = 59/93 (63%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA K F +F RTVTNVG + Y AK++AD + V VNP+VL F+ LNEK Sbjct: 639 NYPSMASTADQHKPFNIRFPRTVTNVGQANSTYQAKITADPLMKVQVNPNVLSFTSLNEK 698 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + F V+ SG L + A+L+W+DG H VRS Sbjct: 699 KTFVVTVSGEALDKQPNVSASLVWTDGTHSVRS 731 >emb|CAN62173.1| hypothetical protein VITISV_027754 [Vitis vinifera] Length = 683 Score = 96.3 bits (238), Expect = 4e-18 Identities = 46/93 (49%), Positives = 59/93 (63%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA K F +F RTVTNVG + Y AK++AD + V VNP+VL F+ LNEK Sbjct: 581 NYPSMASTADQHKPFNIRFPRTVTNVGQANSTYQAKITADPLMKVQVNPNVLSFTSLNEK 640 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + F V+ SG L + A+L+W+DG H VRS Sbjct: 641 KTFVVTVSGEALDKQPNVSASLVWTDGTHSVRS 673 >ref|XP_006424940.1| hypothetical protein CICLE_v10029849mg [Citrus clementina] gi|557526874|gb|ESR38180.1| hypothetical protein CICLE_v10029849mg [Citrus clementina] Length = 657 Score = 95.9 bits (237), Expect = 5e-18 Identities = 46/93 (49%), Positives = 62/93 (66%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA V SGK+F F RTVTNVG + Y AKV + ++++ V P VL F LNEK Sbjct: 559 NYPSMAAQVSSGKSFVVNFPRTVTNVGVANSTYRAKVLQNLKISIKVVPDVLSFKSLNEK 618 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + F+V+ +G+ +P + A+L+WSDG H VRS Sbjct: 619 KSFSVTVTGKGVPHGAIVSASLVWSDGNHWVRS 651 >ref|XP_002271796.2| PREDICTED: cucumisin-like [Vitis vinifera] Length = 727 Score = 94.4 bits (233), Expect = 1e-17 Identities = 46/93 (49%), Positives = 58/93 (62%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA K F F RTVTNVG + Y AK++AD + V VNP+VL F+ LNEK Sbjct: 625 NYPSMASPADQHKPFNISFLRTVTNVGQANSTYQAKITADPLMKVQVNPNVLSFTSLNEK 684 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + V+ SG L + K A+L+W+DG H VRS Sbjct: 685 KSLVVTVSGEALDKQPKVSASLVWTDGTHSVRS 717 >ref|XP_002314148.2| hypothetical protein POPTR_0009s04280g [Populus trichocarpa] gi|550331006|gb|EEE88103.2| hypothetical protein POPTR_0009s04280g [Populus trichocarpa] Length = 745 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/93 (44%), Positives = 62/93 (66%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA+ V+ +AFT KF RTV NVG Y + ++ ++NV+V PS+L ++E+ Sbjct: 642 NYPSMAVRVEENRAFTVKFPRTVRNVGLAKSSYKSNITTGSQINVMVEPSILSLKSVDER 701 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + F V+ +G+ LP NS ++L+W+DG H VRS Sbjct: 702 QSFVVTVAGKGLPANSMVSSSLVWNDGTHSVRS 734 >ref|XP_006432274.1| hypothetical protein CICLE_v10000577mg [Citrus clementina] gi|557534396|gb|ESR45514.1| hypothetical protein CICLE_v10000577mg [Citrus clementina] Length = 630 Score = 90.9 bits (224), Expect = 2e-16 Identities = 45/93 (48%), Positives = 58/93 (62%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA V G++FT FSRTVTNVG + Y AK+ + ++ V V P L F LNEK Sbjct: 530 NYPSMAAQVSPGRSFTINFSRTVTNVGIANTTYKAKILQNSKIGVKVVPQALTFKSLNEK 589 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + F V+ +GR L + +LIW+DG H VRS Sbjct: 590 KSFRVTVTGRGLSNGTIVSTSLIWADGNHNVRS 622 >ref|XP_002314147.1| subtilase family protein [Populus trichocarpa] gi|222850555|gb|EEE88102.1| subtilase family protein [Populus trichocarpa] Length = 710 Score = 90.1 bits (222), Expect = 3e-16 Identities = 46/93 (49%), Positives = 56/93 (60%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA V ++FT KF RTVTNVG + Y AK+ + L + V P L F L EK Sbjct: 600 NYPSMAAKVAVEESFTIKFHRTVTNVGNANSTYKAKIFSRSSLKIKVVPEALSFKSLKEK 659 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + F V+ GR L NS A+L+WSDG H VRS Sbjct: 660 KSFAVTIVGRDLTYNSILSASLVWSDGSHSVRS 692 >gb|EOY34208.1| Subtilase family protein, putative [Theobroma cacao] Length = 765 Score = 89.7 bits (221), Expect = 3e-16 Identities = 44/93 (47%), Positives = 58/93 (62%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPS+ V +GK+FT F RTVTNVG Y KVS++ +L V V P VL F L EK Sbjct: 656 NYPSLTAEVPTGKSFTVGFHRTVTNVGVAGSTYKVKVSSNSKLRVKVIPEVLSFKSLKEK 715 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + + V+ +G+ L +S +L+WSDG H VRS Sbjct: 716 KSYNVTVTGKALDGSSMLSTSLVWSDGTHSVRS 748 >ref|XP_006491889.1| PREDICTED: cucumisin-like [Citrus sinensis] Length = 764 Score = 89.4 bits (220), Expect = 5e-16 Identities = 44/94 (46%), Positives = 61/94 (64%), Gaps = 1/94 (1%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRL-NVVVNPSVLKFSKLNE 110 NYPSMA V GK+FT F RTVTNVG + Y AK+ + ++ ++ V P L F LNE Sbjct: 640 NYPSMAAQVSPGKSFTINFPRTVTNVGLANSTYKAKILQNSKIVSIKVVPESLSFKSLNE 699 Query: 109 KRRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 K+ F+V+ +G+ LP + +L+WSDG H+VRS Sbjct: 700 KKSFSVTVTGKGLPNGAIVSTSLMWSDGNHRVRS 733 >emb|CBI24380.3| unnamed protein product [Vitis vinifera] Length = 760 Score = 89.4 bits (220), Expect = 5e-16 Identities = 43/89 (48%), Positives = 55/89 (61%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPSMA K F F RTVTNVG + Y AK++AD + V VNP+VL F+ LNEK Sbjct: 596 NYPSMASPADQHKPFNISFLRTVTNVGQANSTYQAKITADPLMKVQVNPNVLSFTSLNEK 655 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKH 20 + V+ SG L + K A+L+W+DG H Sbjct: 656 KSLVVTVSGEALDKQPKVSASLVWTDGTH 684 >gb|EMJ21955.1| hypothetical protein PRUPE_ppa024105mg, partial [Prunus persica] Length = 701 Score = 89.0 bits (219), Expect = 6e-16 Identities = 43/93 (46%), Positives = 60/93 (64%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 NYPS+A V+ +FT F+RTV NVG + Y AK+ D ++++ V P VL F LNE+ Sbjct: 598 NYPSLAAVVKPVTSFTINFNRTVKNVGLANSTYKAKILPDSKVDIKVVPQVLSFKSLNEE 657 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + FTV+ G+ LP S A+L+W DG H+VRS Sbjct: 658 KTFTVTVVGKGLPVGSHVSASLVWYDGTHRVRS 690 >ref|XP_006280067.1| hypothetical protein CARUB_v10025949mg [Capsella rubella] gi|482548771|gb|EOA12965.1| hypothetical protein CARUB_v10025949mg [Capsella rubella] Length = 737 Score = 88.2 bits (217), Expect = 1e-15 Identities = 49/96 (51%), Positives = 61/96 (63%), Gaps = 3/96 (3%) Frame = -3 Query: 286 NYPSMALYVQ-SGKAFTAKFSRTVTNVGGGDGKYMAKVSADH--RLNVVVNPSVLKFSKL 116 NYPSM+ + S FT FSRT+TNVG + Y +KV A H +LNV V PSVL F + Sbjct: 630 NYPSMSAKLSGSASTFTVTFSRTLTNVGTPNSTYKSKVVAGHGSKLNVKVTPSVLYFKTV 689 Query: 115 NEKRRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 NEK+ F V+ +GR L + A LIWSDG HKV+S Sbjct: 690 NEKQSFKVTVTGRDLDSEVPSSANLIWSDGTHKVKS 725 >ref|XP_006432273.1| hypothetical protein CICLE_v10004018mg [Citrus clementina] gi|557534395|gb|ESR45513.1| hypothetical protein CICLE_v10004018mg [Citrus clementina] Length = 761 Score = 87.4 bits (215), Expect = 2e-15 Identities = 43/94 (45%), Positives = 60/94 (63%), Gaps = 1/94 (1%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRL-NVVVNPSVLKFSKLNE 110 NYPSM V GK+FT F RTVTNVG + Y AK+ + ++ ++ V P L F LNE Sbjct: 645 NYPSMGAQVSPGKSFTINFPRTVTNVGLANSTYKAKILQNSKIVSIRVVPESLSFKSLNE 704 Query: 109 KRRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 K+ F+V+ +G+ LP + +L+WSDG H+VRS Sbjct: 705 KKSFSVTVTGKGLPNGAIVSTSLMWSDGNHRVRS 738 >ref|XP_006424943.1| hypothetical protein CICLE_v10029841mg, partial [Citrus clementina] gi|557526877|gb|ESR38183.1| hypothetical protein CICLE_v10029841mg, partial [Citrus clementina] Length = 667 Score = 87.4 bits (215), Expect = 2e-15 Identities = 44/93 (47%), Positives = 59/93 (63%) Frame = -3 Query: 286 NYPSMALYVQSGKAFTAKFSRTVTNVGGGDGKYMAKVSADHRLNVVVNPSVLKFSKLNEK 107 N PSMA V SG++FT KF RTVTN+G + Y A++ + +++V V P VL F LNEK Sbjct: 558 NIPSMAAQVSSGESFTIKFPRTVTNIGLPNSTYKARILQNSKISVNVVPEVLSFRSLNEK 617 Query: 106 RRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 + F V+ +G+ L S A L+W DG H VRS Sbjct: 618 KSFIVTVTGKGLASGSIVSAALVWFDGSHIVRS 650 >dbj|BAB09626.1| subtilisin-like serine protease [Arabidopsis thaliana] Length = 693 Score = 86.7 bits (213), Expect = 3e-15 Identities = 48/96 (50%), Positives = 60/96 (62%), Gaps = 3/96 (3%) Frame = -3 Query: 286 NYPSMALYVQSGKA-FTAKFSRTVTNVGGGDGKYMAKVSADH--RLNVVVNPSVLKFSKL 116 NYPSM+ + K+ FT F+RTVTNVG + Y +KV +H +L V V+PSVL + Sbjct: 583 NYPSMSAKLSKSKSSFTVTFNRTVTNVGTSNSTYKSKVVINHGSKLKVKVSPSVLSMKSV 642 Query: 115 NEKRRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRS 8 NEK+ FTVS SG L + A LIWSDG H VRS Sbjct: 643 NEKQSFTVSVSGNDLNPKLPSSANLIWSDGTHNVRS 678 >ref|XP_006281781.1| hypothetical protein CARUB_v10027951mg [Capsella rubella] gi|482550485|gb|EOA14679.1| hypothetical protein CARUB_v10027951mg [Capsella rubella] Length = 705 Score = 86.7 bits (213), Expect = 3e-15 Identities = 46/98 (46%), Positives = 64/98 (65%), Gaps = 3/98 (3%) Frame = -3 Query: 286 NYPSMALYV-QSGKAFTAKFSRTVTNVGGGDGKYMAKVSADH--RLNVVVNPSVLKFSKL 116 NYPSMA + ++ +FT F RTVTN+G + Y +K+ + +LNV V+PSVL F ++ Sbjct: 600 NYPSMAAKIYETNSSFTVTFKRTVTNLGIPNSTYKSKIDLNRGSKLNVEVSPSVLSFRRV 659 Query: 115 NEKRRFTVSFSGRPLPRNSKAPATLIWSDGKHKVRSVM 2 NEK+ FTV+ SG L R + A L+W DG H VRSV+ Sbjct: 660 NEKQSFTVTGSGNNLNRKQPSSANLMWFDGTHNVRSVV 697