BLASTX nr result
ID: Zingiber25_contig00047741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00047741 (290 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN80831.1| hypothetical protein VITISV_002503 [Vitis vinifera] 56 6e-06 >emb|CAN80831.1| hypothetical protein VITISV_002503 [Vitis vinifera] Length = 977 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/52 (46%), Positives = 35/52 (67%) Frame = +2 Query: 17 LSP*SLKCIFLHYLNI*KGYHCYSLESYHVFIFANMSFFKSTSFYSFAPSSI 172 LS +KC+FL Y + KGY CYSLE++ FIF +++FFK + F+S S+ Sbjct: 560 LSAKGMKCLFLGYSRLQKGYRCYSLETHRYFIFVDVTFFKDSPFFSTTSESL 611