BLASTX nr result
ID: Zingiber25_contig00047222
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00047222 (390 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN65243.1| hypothetical protein VITISV_010925 [Vitis vinifera] 70 2e-10 gb|EXC25116.1| hypothetical protein L484_003040 [Morus notabilis] 68 1e-09 ref|XP_004144384.1| PREDICTED: protein XRI1-like [Cucumis sativu... 67 3e-09 ref|XP_006360750.1| PREDICTED: protein XRI1-like [Solanum tubero... 64 2e-08 ref|XP_004247587.1| PREDICTED: protein XRI1-like [Solanum lycope... 64 2e-08 ref|XP_006476585.1| PREDICTED: protein XRI1-like [Citrus sinensis] 64 3e-08 ref|XP_006439567.1| hypothetical protein CICLE_v10021149mg [Citr... 64 3e-08 ref|XP_006840930.1| hypothetical protein AMTR_s00087p00169870 [A... 63 4e-08 gb|EMJ03086.1| hypothetical protein PRUPE_ppa009835mg [Prunus pe... 63 5e-08 ref|XP_002521080.1| conserved hypothetical protein [Ricinus comm... 63 5e-08 ref|XP_004290201.1| PREDICTED: protein XRI1-like [Fragaria vesca... 62 6e-08 ref|XP_006486639.1| PREDICTED: protein XRI1-like isoform X4 [Cit... 62 1e-07 ref|XP_006486637.1| PREDICTED: protein XRI1-like isoform X2 [Cit... 62 1e-07 ref|XP_006486636.1| PREDICTED: protein XRI1-like isoform X1 [Cit... 62 1e-07 gb|ESW06107.1| hypothetical protein PHAVU_010G020000g [Phaseolus... 62 1e-07 ref|XP_006422471.1| hypothetical protein CICLE_v10028898mg [Citr... 62 1e-07 ref|XP_004516312.1| PREDICTED: protein XRI1-like [Cicer arietinum] 62 1e-07 gb|EOX93911.1| X-ray induced transcript 1, putative [Theobroma c... 61 1e-07 ref|XP_002303048.2| hypothetical protein POPTR_0002s24550g [Popu... 61 2e-07 ref|XP_006386874.1| hypothetical protein POPTR_0002s24550g [Popu... 61 2e-07 >emb|CAN65243.1| hypothetical protein VITISV_010925 [Vitis vinifera] Length = 320 Score = 70.5 bits (171), Expect = 2e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS++YPTSAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 283 DPSVSYPTSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 320 >gb|EXC25116.1| hypothetical protein L484_003040 [Morus notabilis] Length = 303 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS+ +PTSAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 266 DPSVAFPTSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 303 >ref|XP_004144384.1| PREDICTED: protein XRI1-like [Cucumis sativus] gi|449529551|ref|XP_004171763.1| PREDICTED: protein XRI1-like [Cucumis sativus] Length = 304 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS +YPTSAFSGKPVV KTKI TEGGKGSITI+RT+G Sbjct: 267 DPSESYPTSAFSGKPVVGKTKIHTEGGKGSITIMRTRG 304 >ref|XP_006360750.1| PREDICTED: protein XRI1-like [Solanum tuberosum] Length = 293 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS+ YP SAFSGKPVV KT I TEGGKGSITI+RTKG Sbjct: 256 DPSVAYPKSAFSGKPVVGKTTIPTEGGKGSITIMRTKG 293 >ref|XP_004247587.1| PREDICTED: protein XRI1-like [Solanum lycopersicum] Length = 293 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS+ YP SAFSGKPVV KT I TEGGKGSITI+RTKG Sbjct: 256 DPSVAYPKSAFSGKPVVGKTTIPTEGGKGSITIMRTKG 293 >ref|XP_006476585.1| PREDICTED: protein XRI1-like [Citrus sinensis] Length = 325 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS YPTSAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 289 DPSA-YPTSAFSGKPVVGKTKIHTEGGKGSITIMRTKG 325 >ref|XP_006439567.1| hypothetical protein CICLE_v10021149mg [Citrus clementina] gi|557541829|gb|ESR52807.1| hypothetical protein CICLE_v10021149mg [Citrus clementina] Length = 325 Score = 63.5 bits (153), Expect = 3e-08 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS YPTSAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 289 DPSA-YPTSAFSGKPVVGKTKIHTEGGKGSITIMRTKG 325 >ref|XP_006840930.1| hypothetical protein AMTR_s00087p00169870 [Amborella trichopoda] gi|548842785|gb|ERN02605.1| hypothetical protein AMTR_s00087p00169870 [Amborella trichopoda] Length = 321 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 D S +YPTSAFSGKPVV TKI TEGGKGSITI+RTKG Sbjct: 284 DASPSYPTSAFSGKPVVALTKIHTEGGKGSITIMRTKG 321 >gb|EMJ03086.1| hypothetical protein PRUPE_ppa009835mg [Prunus persica] Length = 275 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DP+ YPTSAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 239 DPAA-YPTSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 275 >ref|XP_002521080.1| conserved hypothetical protein [Ricinus communis] gi|223539649|gb|EEF41231.1| conserved hypothetical protein [Ricinus communis] Length = 293 Score = 62.8 bits (151), Expect = 5e-08 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DP+ YPTSAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 257 DPAA-YPTSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 293 >ref|XP_004290201.1| PREDICTED: protein XRI1-like [Fragaria vesca subsp. vesca] Length = 299 Score = 62.4 bits (150), Expect = 6e-08 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 17 YPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 YPTSAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 267 YPTSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 299 >ref|XP_006486639.1| PREDICTED: protein XRI1-like isoform X4 [Citrus sinensis] Length = 275 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS YP SAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 239 DPSA-YPKSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 275 >ref|XP_006486637.1| PREDICTED: protein XRI1-like isoform X2 [Citrus sinensis] gi|568866596|ref|XP_006486638.1| PREDICTED: protein XRI1-like isoform X3 [Citrus sinensis] Length = 276 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS YP SAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 240 DPSA-YPKSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 276 >ref|XP_006486636.1| PREDICTED: protein XRI1-like isoform X1 [Citrus sinensis] Length = 277 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS YP SAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 241 DPSA-YPKSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 277 >gb|ESW06107.1| hypothetical protein PHAVU_010G020000g [Phaseolus vulgaris] Length = 311 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS YP SAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 275 DPSA-YPKSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 311 >ref|XP_006422471.1| hypothetical protein CICLE_v10028898mg [Citrus clementina] gi|557524405|gb|ESR35711.1| hypothetical protein CICLE_v10028898mg [Citrus clementina] Length = 308 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS YP SAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 272 DPSA-YPKSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 308 >ref|XP_004516312.1| PREDICTED: protein XRI1-like [Cicer arietinum] Length = 295 Score = 61.6 bits (148), Expect = 1e-07 Identities = 32/38 (84%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DPS YP SAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 259 DPSA-YPKSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 295 >gb|EOX93911.1| X-ray induced transcript 1, putative [Theobroma cacao] Length = 301 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/38 (78%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 D + +PTSAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 264 DLAAAFPTSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 301 >ref|XP_002303048.2| hypothetical protein POPTR_0002s24550g [Populus trichocarpa] gi|550345746|gb|EEE82321.2| hypothetical protein POPTR_0002s24550g [Populus trichocarpa] Length = 309 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DP + YP SAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 273 DPVV-YPMSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 309 >ref|XP_006386874.1| hypothetical protein POPTR_0002s24550g [Populus trichocarpa] gi|550345745|gb|ERP64671.1| hypothetical protein POPTR_0002s24550g [Populus trichocarpa] Length = 302 Score = 60.8 bits (146), Expect = 2e-07 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +2 Query: 2 DPSINYPTSAFSGKPVVVKTKILTEGGKGSITILRTKG 115 DP + YP SAFSGKPVV KTKI TEGGKGSITI+RTKG Sbjct: 266 DPVV-YPMSAFSGKPVVGKTKIRTEGGKGSITIMRTKG 302