BLASTX nr result
ID: Zingiber25_contig00047011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00047011 (355 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002321884.1| hypothetical protein POPTR_0015s13690g [Popu... 57 3e-06 >ref|XP_002321884.1| hypothetical protein POPTR_0015s13690g [Populus trichocarpa] gi|222868880|gb|EEF06011.1| hypothetical protein POPTR_0015s13690g [Populus trichocarpa] Length = 645 Score = 57.0 bits (136), Expect = 3e-06 Identities = 32/70 (45%), Positives = 41/70 (58%), Gaps = 6/70 (8%) Frame = -2 Query: 195 MQYSCIKD---RCAQICFPVP---FQEPSNAVPQAKATSTRISRSNFVKSTMDSIFPNTH 34 MQ C+K+ C C P P F EP N + + ++TS R NF K+T SIFPNTH Sbjct: 1 MQPRCLKEVSQACLSGCCPSPILGFSEPLNKISKPRSTSATC-RQNFAKTTTSSIFPNTH 59 Query: 33 FTDHESVPPL 4 FT+ ES+P L Sbjct: 60 FTNPESLPSL 69