BLASTX nr result
ID: Zingiber25_contig00046888
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00046888 (368 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB26553.1| hypothetical protein L484_012544 [Morus notabilis] 57 2e-06 >gb|EXB26553.1| hypothetical protein L484_012544 [Morus notabilis] Length = 333 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/58 (41%), Positives = 37/58 (63%) Frame = -3 Query: 366 DTHSWKVARIVKIVKNKYVVAKIFGSIQLKRFSIYDAARVSQAWQNNNWFDKVESERH 193 D+ W+V ++ K+++NK +V K FGSIQLK F + + R Q W+ N W D V+ + H Sbjct: 84 DSQCWRVGKVAKVLRNKRLVVKFFGSIQLKEFHVSN-LRFRQVWRENKWSDFVKIQNH 140