BLASTX nr result
ID: Zingiber25_contig00046683
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00046683 (347 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI17575.3| unnamed protein product [Vitis vinifera] 55 7e-06 ref|XP_002269078.1| PREDICTED: pentatricopeptide repeat-containi... 55 7e-06 >emb|CBI17575.3| unnamed protein product [Vitis vinifera] Length = 656 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/52 (46%), Positives = 36/52 (69%) Frame = +2 Query: 38 GTYEVMILGLQRCGRFADAEVCRKEKKKIRGNKYYQDKISLDEIFCNFLFEG 193 GTY +++ GL++ GR +AE+ RKEKK + + + QD +S+DE CN LF G Sbjct: 601 GTYNLLLAGLEKKGRAREAEIYRKEKKTLHTHGHSQDIVSMDEKICNLLFSG 652 >ref|XP_002269078.1| PREDICTED: pentatricopeptide repeat-containing protein At2g01390-like [Vitis vinifera] Length = 519 Score = 55.5 bits (132), Expect = 7e-06 Identities = 24/52 (46%), Positives = 36/52 (69%) Frame = +2 Query: 38 GTYEVMILGLQRCGRFADAEVCRKEKKKIRGNKYYQDKISLDEIFCNFLFEG 193 GTY +++ GL++ GR +AE+ RKEKK + + + QD +S+DE CN LF G Sbjct: 464 GTYNLLLAGLEKKGRAREAEIYRKEKKTLHTHGHSQDIVSMDEKICNLLFSG 515