BLASTX nr result
ID: Zingiber25_contig00046628
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00046628 (424 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006390816.1| hypothetical protein EUTSA_v10018002mg [Eutr... 55 1e-05 >ref|XP_006390816.1| hypothetical protein EUTSA_v10018002mg [Eutrema salsugineum] gi|557087250|gb|ESQ28102.1| hypothetical protein EUTSA_v10018002mg [Eutrema salsugineum] Length = 1644 Score = 55.1 bits (131), Expect = 1e-05 Identities = 24/39 (61%), Positives = 31/39 (79%), Gaps = 1/39 (2%) Frame = -1 Query: 115 LNFKND-EIFYPPPPEDEGGWLETNYFAYSDEDDSVGES 2 L+F+N+ I+YPPPPEDE E+NYFAY DEDD +G+S Sbjct: 259 LDFENNGRIWYPPPPEDENDDAESNYFAYDDEDDDIGDS 297