BLASTX nr result
ID: Zingiber25_contig00046513
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00046513 (305 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFE85505.1| putative CC-NBS-LRR disease resistance protein, p... 82 7e-14 >gb|AFE85505.1| putative CC-NBS-LRR disease resistance protein, partial [Zingiber zerumbet] Length = 759 Score = 82.0 bits (201), Expect = 7e-14 Identities = 39/52 (75%), Positives = 45/52 (86%) Frame = +1 Query: 61 IQETMARLRGKRDDIKNQIDQAEREGKIPTNEVSQWLREVEKLEGQVATINQ 216 +++ M RLR KRDDIKNQI++AEREGKIPTNEVSQWLRE E LEG+VA I Q Sbjct: 76 LEKEMTRLRSKRDDIKNQINEAEREGKIPTNEVSQWLREAEILEGKVADIEQ 127