BLASTX nr result
ID: Zingiber25_contig00045558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00045558 (333 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAT67244.1| BTF3b-like transcription factor [Musa acuminata] 56 4e-06 >gb|AAT67244.1| BTF3b-like transcription factor [Musa acuminata] Length = 157 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/57 (52%), Positives = 42/57 (73%), Gaps = 2/57 (3%) Frame = -2 Query: 233 DAIPTTVT-LCVDNLDNLRKFAKQF*RRSPEAAAPKGGK-DDDIPDLVLGKTFEQAA 69 D +P + L DNL+NLRK A+QF R++P A+A G + DDD+P+LV G+TFE+AA Sbjct: 95 DLLPAIINQLGPDNLENLRKLAEQFQRQAPAASAATGEEDDDDVPELVPGETFEEAA 151