BLASTX nr result
ID: Zingiber25_contig00045457
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00045457 (353 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002305943.2| hypothetical protein POPTR_0004s07030g [Popu... 56 4e-06 >ref|XP_002305943.2| hypothetical protein POPTR_0004s07030g [Populus trichocarpa] gi|550340500|gb|EEE86454.2| hypothetical protein POPTR_0004s07030g [Populus trichocarpa] Length = 771 Score = 56.2 bits (134), Expect = 4e-06 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = +1 Query: 229 GLCLHSFIIKLGFRDQLPLSNHLLGFYSKCCGLDSARKLFD 351 G+C+HS IIKLGF+D L L+N+LL YSKC LD AR+ FD Sbjct: 37 GVCIHSPIIKLGFQDHLYLNNNLLSLYSKCFTLDYARQFFD 77