BLASTX nr result
ID: Zingiber25_contig00045152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00045152 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006826317.1| hypothetical protein AMTR_s00004p00087070 [A... 60 3e-07 >ref|XP_006826317.1| hypothetical protein AMTR_s00004p00087070 [Amborella trichopoda] gi|548830631|gb|ERM93554.1| hypothetical protein AMTR_s00004p00087070 [Amborella trichopoda] Length = 447 Score = 60.1 bits (144), Expect = 3e-07 Identities = 41/93 (44%), Positives = 51/93 (54%), Gaps = 3/93 (3%) Frame = +2 Query: 77 QILKSAHSHHPFLLTRLAHTYLSASLLPAAQTIXXXXXXXXXXXX--WSETIKAYSRNGR 250 QILK+ HS LL+RLAH YL L A + W+E +K YSRNG Sbjct: 41 QILKTQHSEDLSLLSRLAHRYLLCHCLGDALQVFAQMKREKDPHVFLWNEFVKWYSRNGF 100 Query: 251 FRSALDVYHRILSLG-VCPNEFTFTFTFVLPAC 346 + +++ Y R LSL PNE FTFTF+LPAC Sbjct: 101 YIESMEFY-RCLSLSKTPPNE--FTFTFILPAC 130