BLASTX nr result
ID: Zingiber25_contig00045133
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00045133 (457 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002445915.1| hypothetical protein SORBIDRAFT_07g027970 [S... 55 1e-05 >ref|XP_002445915.1| hypothetical protein SORBIDRAFT_07g027970 [Sorghum bicolor] gi|241942265|gb|EES15410.1| hypothetical protein SORBIDRAFT_07g027970 [Sorghum bicolor] Length = 357 Score = 55.1 bits (131), Expect = 1e-05 Identities = 26/54 (48%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = +3 Query: 276 MVVADSNSFNKETLII--RHPKKYPLKLWVAVVGLFMLSGIYIFSLCLKQRGFL 431 M D K+T ++ + K+YPL LW+A++GL ML G+YIFSL LKQ G L Sbjct: 10 MAAEDLGVATKDTAVVNTKPAKRYPLALWIAILGLIMLVGVYIFSLSLKQNGML 63