BLASTX nr result
ID: Zingiber25_contig00044887
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00044887 (665 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008854652.1| hypothetical chloroplast RF19 [Curcuma rosco... 63 7e-08 gb|AGE93428.1| hypothetical chloroplast RF19 [Alpinia zerumbet] 63 7e-08 ref|YP_007475762.1| hypothetical chloroplast RF19 [Zingiber spec... 58 2e-06 >ref|YP_008854652.1| hypothetical chloroplast RF19 [Curcuma roscoeana] gi|557637559|gb|AHA13154.1| hypothetical chloroplast RF19 [Curcuma roscoeana] Length = 1815 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 655 IQSMNWTNFLFIENEMKDLADMTIIIRNPIEE 560 IQSMNWTNFLFIENEMKDLAD TIIIRN IEE Sbjct: 992 IQSMNWTNFLFIENEMKDLADKTIIIRNQIEE 1023 >gb|AGE93428.1| hypothetical chloroplast RF19 [Alpinia zerumbet] Length = 1795 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -2 Query: 655 IQSMNWTNFLFIENEMKDLADMTIIIRNPIEE 560 IQSMNWTNFLFIENEMKDLAD TIIIRN IEE Sbjct: 992 IQSMNWTNFLFIENEMKDLADKTIIIRNQIEE 1023 >ref|YP_007475762.1| hypothetical chloroplast RF19 [Zingiber spectabile] gi|449326242|gb|AGE92827.1| hypothetical chloroplast RF19 [Zingiber spectabile] Length = 1817 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/34 (88%), Positives = 30/34 (88%), Gaps = 2/34 (5%) Frame = -2 Query: 655 IQSMNWTNFLFIE--NEMKDLADMTIIIRNPIEE 560 IQSMNWTNFLFIE NEMKDLAD TIIIRN IEE Sbjct: 1001 IQSMNWTNFLFIEIENEMKDLADKTIIIRNQIEE 1034