BLASTX nr result
ID: Zingiber25_contig00044114
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00044114 (446 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] 40 4e-06 >emb|CAC95126.1| gag-pol polyprotein [Populus deltoides] Length = 1382 Score = 39.7 bits (91), Expect(2) = 4e-06 Identities = 23/49 (46%), Positives = 32/49 (65%), Gaps = 1/49 (2%) Frame = +2 Query: 239 EDSRSQKXXXXXXXXXXLYVLDKLQVP-DIAASSVNLSSFRLSCSSDFF 382 +D +SQK LY+LD+L+VP +AA++V+LS FRLS SS F Sbjct: 430 QDLQSQKLIGTGRRENGLYILDELKVPVVVAATTVDLSFFRLSLSSSSF 478 Score = 36.2 bits (82), Expect(2) = 4e-06 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = +3 Query: 381 FYLWHTHLDHVSVSRL*FLASS 446 FYLWH+ L HVS SRL FLAS+ Sbjct: 478 FYLWHSRLGHVSSSRLRFLAST 499