BLASTX nr result
ID: Zingiber25_contig00044082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00044082 (346 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS65985.1| hypothetical protein M569_08788, partial [Genlise... 57 3e-06 ref|XP_003631828.1| PREDICTED: dnaJ homolog subfamily B member 1... 57 3e-06 ref|NP_001130118.1| uncharacterized protein LOC100191212 [Zea ma... 57 3e-06 ref|XP_002284572.1| PREDICTED: dnaJ homolog subfamily B member 1... 57 3e-06 ref|XP_006844396.1| hypothetical protein AMTR_s00142p00096730 [A... 56 6e-06 ref|XP_006298073.1| hypothetical protein CARUB_v10014117mg [Caps... 55 1e-05 >gb|EPS65985.1| hypothetical protein M569_08788, partial [Genlisea aurea] Length = 311 Score = 56.6 bits (135), Expect = 3e-06 Identities = 22/32 (68%), Positives = 31/32 (96%) Frame = -3 Query: 98 GMGVDYYNVLEVGRSASDEELKKSYRKLAIRW 3 GMGVDYYN+L+VGR A++E+LKK+YR+LA++W Sbjct: 1 GMGVDYYNILKVGRGATEEDLKKAYRRLAMKW 32 >ref|XP_003631828.1| PREDICTED: dnaJ homolog subfamily B member 13 isoform 2 [Vitis vinifera] Length = 273 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/31 (74%), Positives = 31/31 (100%) Frame = -3 Query: 95 MGVDYYNVLEVGRSASDEELKKSYRKLAIRW 3 MGVDYYNVL+VG++A+DE+LKKSYR+LA++W Sbjct: 1 MGVDYYNVLKVGKNATDEDLKKSYRRLAMKW 31 >ref|NP_001130118.1| uncharacterized protein LOC100191212 [Zea mays] gi|194688338|gb|ACF78253.1| unknown [Zea mays] gi|223943815|gb|ACN25991.1| unknown [Zea mays] gi|413936842|gb|AFW71393.1| hypothetical protein ZEAMMB73_179014 [Zea mays] Length = 346 Score = 56.6 bits (135), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -3 Query: 95 MGVDYYNVLEVGRSASDEELKKSYRKLAIRW 3 MGVDYY VL+VGR ASD+ELKK+YRKLA++W Sbjct: 1 MGVDYYKVLQVGRGASDDELKKAYRKLAMKW 31 >ref|XP_002284572.1| PREDICTED: dnaJ homolog subfamily B member 13 isoform 1 [Vitis vinifera] gi|296081929|emb|CBI20934.3| unnamed protein product [Vitis vinifera] Length = 339 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/31 (74%), Positives = 31/31 (100%) Frame = -3 Query: 95 MGVDYYNVLEVGRSASDEELKKSYRKLAIRW 3 MGVDYYNVL+VG++A+DE+LKKSYR+LA++W Sbjct: 1 MGVDYYNVLKVGKNATDEDLKKSYRRLAMKW 31 >ref|XP_006844396.1| hypothetical protein AMTR_s00142p00096730 [Amborella trichopoda] gi|548846842|gb|ERN06071.1| hypothetical protein AMTR_s00142p00096730 [Amborella trichopoda] Length = 328 Score = 55.8 bits (133), Expect = 6e-06 Identities = 23/31 (74%), Positives = 29/31 (93%) Frame = -3 Query: 95 MGVDYYNVLEVGRSASDEELKKSYRKLAIRW 3 MGVDYYN+L+V RSASDE++KKSY +LA+RW Sbjct: 1 MGVDYYNILKVSRSASDEDIKKSYHRLAMRW 31 >ref|XP_006298073.1| hypothetical protein CARUB_v10014117mg [Capsella rubella] gi|482566782|gb|EOA30971.1| hypothetical protein CARUB_v10014117mg [Capsella rubella] Length = 339 Score = 55.1 bits (131), Expect = 1e-05 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -3 Query: 95 MGVDYYNVLEVGRSASDEELKKSYRKLAIRW 3 MGVDYYNVL+V RSAS+++LKK+YRKLA++W Sbjct: 1 MGVDYYNVLQVDRSASEDDLKKAYRKLAMKW 31