BLASTX nr result
ID: Zingiber25_contig00043984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00043984 (360 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC20297.1| hypothetical protein L484_020516 [Morus notabilis] 57 3e-06 >gb|EXC20297.1| hypothetical protein L484_020516 [Morus notabilis] Length = 169 Score = 56.6 bits (135), Expect = 3e-06 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 16/78 (20%) Frame = +2 Query: 17 EKGKKKATPRGAEET--------AARRSDWEE--------ARELVEGMGSRFEPDRIWLE 148 ++ KK T RG +T +R W E + E +E + +RFE +R+WLE Sbjct: 86 KRKKKTTTERGGYDTDGDVVGEEESRERWWREEGVLEISRSEEGMECVSARFEAERVWLE 145 Query: 149 LYQIGQWGFGRLSFSGLQ 202 LYQIG GFGRLSF+G+Q Sbjct: 146 LYQIGHLGFGRLSFTGIQ 163