BLASTX nr result
ID: Zingiber25_contig00043558
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00043558 (330 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002444411.1| hypothetical protein SORBIDRAFT_07g021540 [S... 56 6e-06 >ref|XP_002444411.1| hypothetical protein SORBIDRAFT_07g021540 [Sorghum bicolor] gi|241940761|gb|EES13906.1| hypothetical protein SORBIDRAFT_07g021540 [Sorghum bicolor] Length = 418 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/54 (53%), Positives = 34/54 (62%) Frame = +1 Query: 157 MPDRILVCFRXXXXXXXXPSVPSLTTSVYETCLGVACLTWSRDALGVSLCAVLR 318 MP I CFR + PSL TSVYET LG+ L+WSR +LG+SL AVLR Sbjct: 1 MPSPIAACFRCAAAPSSGAAGPSLATSVYETHLGLVALSWSRTSLGLSLRAVLR 54