BLASTX nr result
ID: Zingiber25_contig00042552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00042552 (453 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABY83903.1| cytochrome oxidase subunit 1 [Kaempferia rotunda] 69 6e-10 dbj|BAJ22082.1| cytochrome c oxidase subunit 1 [Cycas taitungensis] 68 1e-09 gb|ABY83864.1| cytochrome oxidase subunit 1 [Ochrosia elliptica] 68 1e-09 dbj|BAO50887.1| cytochrome c oxidase subunit 1 (mitochondrion) [... 67 2e-09 gb|AHI16392.1| cox1, partial (mitochondrion) [Triticum durum] 67 2e-09 ref|YP_173395.1| cytochrome oxidase subunit 1 [Nicotiana tabacum] 67 2e-09 ref|NP_054454.1| cytochrome c oxidase subunit 1 [Marchantia poly... 67 2e-09 sp|P08743.2|COX1_OENBE RecName: Full=Cytochrome c oxidase subuni... 67 2e-09 ref|YP_762344.1| cytochrome c oxidase subunit 1 [Sorghum bicolor... 67 2e-09 ref|NP_085587.1| cytochrome c oxidase subunit 1 [Arabidopsis tha... 67 2e-09 ref|YP_398419.1| cox1 [Triticum aestivum] gi|556927013|ref|YP_00... 67 2e-09 ref|YP_008999560.1| cytochrome c oxidase subunit 1 (mitochondrio... 67 2e-09 ref|YP_008992359.1| cytochrome c oxidase subunit 1 (mitochondrio... 67 2e-09 gb|AHC94287.1| cytochrome c oxidase subunit 1, partial (mitochon... 67 2e-09 gb|AHA47096.1| cytochrome c oxidase subunit 1 (mitochondrion) [A... 67 2e-09 ref|YP_008802500.1| cytochrome c oxidase subunit 1 (mitochondrio... 67 2e-09 gb|AFO69207.1| cytochrome c oxidase subunit 1 (mitochondrion) [G... 67 2e-09 gb|EPS74621.1| cytochrome c oxidase subunit 1 [Genlisea aurea] 67 2e-09 ref|XP_004516990.1| PREDICTED: cytochrome c oxidase subunit 1-li... 67 2e-09 gb|AGC78973.1| cytochrome c oxidase subunit I (mitochondrion) [V... 67 2e-09 >gb|ABY83903.1| cytochrome oxidase subunit 1 [Kaempferia rotunda] Length = 508 Score = 68.9 bits (167), Expect = 6e-10 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS Sbjct: 1 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 31 >dbj|BAJ22082.1| cytochrome c oxidase subunit 1 [Cycas taitungensis] Length = 107 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNH+DIGTLYLIFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHRDIGTLYLIFGAIAGVMGTCFS 35 >gb|ABY83864.1| cytochrome oxidase subunit 1 [Ochrosia elliptica] Length = 519 Score = 67.8 bits (164), Expect = 1e-09 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -3 Query: 97 TVRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 +VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 4 SVRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >dbj|BAO50887.1| cytochrome c oxidase subunit 1 (mitochondrion) [Hevea brasiliensis] Length = 527 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >gb|AHI16392.1| cox1, partial (mitochondrion) [Triticum durum] Length = 523 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >ref|YP_173395.1| cytochrome oxidase subunit 1 [Nicotiana tabacum] Length = 527 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >ref|NP_054454.1| cytochrome c oxidase subunit 1 [Marchantia polymorpha] gi|461785|sp|P26856.2|COX1_MARPO RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|786237|gb|AAC09451.1| coxI [Marchantia polymorpha] Length = 522 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -3 Query: 91 RWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 RWLFSTNHKDIGTLYLIFGAIAGVMGTCFS Sbjct: 7 RWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 36 >sp|P08743.2|COX1_OENBE RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|13167|emb|CAA29025.1| unnamed protein product [Oenothera berteroana] Length = 527 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >ref|YP_762344.1| cytochrome c oxidase subunit 1 [Sorghum bicolor] gi|1169032|sp|P05502.2|COX1_SORBI RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|868015|gb|AAA68624.1| cytochrome c oxidase subunit I [Sorghum bicolor] gi|114309657|gb|ABI60874.1| cytochrome c oxidase subunit 1 (mitochondrion) [Sorghum bicolor] Length = 530 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >ref|NP_085587.1| cytochrome c oxidase subunit 1 [Arabidopsis thaliana] gi|112253911|ref|YP_717165.1| cytochrome c oxidase subunit 1 [Brassica napus] gi|353526416|ref|YP_004927488.1| cox1 (mitochondrion) [Brassica oleracea] gi|353526497|ref|YP_004927568.1| cox1 (mitochondrion) [Brassica carinata] gi|353526672|ref|YP_004927841.1| cox1 (mitochondrion) [Brassica rapa subsp. oleifera] gi|353531355|ref|YP_004927744.1| cox1 (mitochondrion) [Brassica juncea] gi|404481670|ref|YP_006666004.1| cytochrome c oxidase subunit 1 (mitochondrion) [Raphanus sativus] gi|45593157|sp|P60620.1|COX1_ARATH RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|45593158|sp|P60621.1|COX1_RAPSA RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|297416|emb|CAA40873.1| cytochrome c oxidase subunit I [Raphanus sativus] gi|1785788|emb|CAA69785.1| cytochrome c oxidase subunit 1 [Arabidopsis thaliana] gi|31790107|gb|AAP58355.1| cytochrome oxidase subunit I [Brassica juncea] gi|37591113|dbj|BAC98915.1| cytochrome c oxidase subunit 1 [Brassica napus] gi|335354860|gb|AEH43416.1| cox1 [Brassica rapa subsp. oleifera] gi|335354961|gb|AEH43516.1| cox1 [Brassica oleracea] gi|335355028|gb|AEH43582.1| cox1 [Brassica carinata] gi|335355088|gb|AEH43641.1| cox1 [Brassica juncea] gi|339511287|emb|CBX48342.1| cox1 [Brassica napus] gi|339773248|gb|AEK01272.1| cox1 [Arabidopsis thaliana] gi|339773256|gb|AEK01279.1| cox1 [Arabidopsis thaliana] gi|339773308|gb|AEK01330.1| cox1 [Arabidopsis thaliana] gi|371925873|gb|AEX57674.1| cytochrome c oxidase subunit 1 (mitochondrion) [Raphanus sativus] gi|400278288|dbj|BAM36212.1| cytochrome c oxidase subunit 1 (mitochondrion) [Raphanus sativus] gi|400278324|dbj|BAM36247.1| cytochrome c oxidase subunit 1 (mitochondrion) [Raphanus sativus] gi|443298127|gb|AGC81671.1| cytochrome c oxidase subunit 1 (mitochondrion) [Raphanus sativus] Length = 527 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >ref|YP_398419.1| cox1 [Triticum aestivum] gi|556927013|ref|YP_008757371.1| cytochrome c oxidase subunit 1 (mitochondrion) [Aegilops speltoides] gi|556927179|ref|YP_008758136.1| cytochrome c oxidase subunit 1 (mitochondrion) [Triticum timopheevii] gi|55976797|sp|P68539.1|COX1_WHEAT RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|55976798|sp|P68540.1|COX1_AEGCO RecName: Full=Cytochrome c oxidase subunit 1; AltName: Full=Cytochrome c oxidase polypeptide I gi|13689|emb|CAA68474.1| unnamed protein product [Triticum aestivum] gi|13696|emb|CAA39651.1| cytochrome-c oxidase subunit I [Triticum aestivum x Triticum timopheevi] gi|1213422|gb|AAA91209.1| cytochrome c oxidase subunit I [Aegilops columnaris] gi|78675259|dbj|BAE47684.1| cox1 [Triticum aestivum] gi|169649068|gb|ACA62629.1| cox1 [Triticum aestivum] gi|549067726|dbj|BAN94698.1| cytochrome c oxidase subunit 1 (mitochondrion) [Triticum timopheevii] gi|549067777|dbj|BAN94748.1| cytochrome c oxidase subunit 1 (mitochondrion) [Aegilops speltoides] gi|578888246|gb|AHI16351.1| cox1 (mitochondrion) [Aegilops longissima] gi|578888256|gb|AHI16360.1| cox1 (mitochondrion) [Triticum durum] Length = 524 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >ref|YP_008999560.1| cytochrome c oxidase subunit 1 (mitochondrion) [Helianthus annuus] gi|571031388|gb|AHF21033.1| cytochrome c oxidase subunit 1 (mitochondrion) [Helianthus annuus] Length = 564 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 42 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 72 >ref|YP_008992359.1| cytochrome c oxidase subunit 1 (mitochondrion) [Salvia miltiorrhiza] gi|534292330|gb|AGU16622.1| cytochrome c oxidase subunit 1 (mitochondrion) [Salvia miltiorrhiza] Length = 527 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >gb|AHC94287.1| cytochrome c oxidase subunit 1, partial (mitochondrion) [Amborella trichopoda] Length = 490 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 2 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 32 >gb|AHA47096.1| cytochrome c oxidase subunit 1 (mitochondrion) [Amborella trichopoda] Length = 527 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >ref|YP_008802500.1| cytochrome c oxidase subunit 1 (mitochondrion) [Asclepias syriaca] gi|556562339|gb|AGZ63035.1| cytochrome c oxidase subunit 1 (mitochondrion) [Asclepias syriaca] Length = 525 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >gb|AFO69207.1| cytochrome c oxidase subunit 1 (mitochondrion) [Gossypium hirsutum] Length = 530 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >gb|EPS74621.1| cytochrome c oxidase subunit 1 [Genlisea aurea] Length = 528 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >ref|XP_004516990.1| PREDICTED: cytochrome c oxidase subunit 1-like [Cicer arietinum] Length = 428 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35 >gb|AGC78973.1| cytochrome c oxidase subunit I (mitochondrion) [Vicia faba] Length = 527 Score = 67.4 bits (163), Expect = 2e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = -3 Query: 94 VRWLFSTNHKDIGTLYLIFGAIAGVMGTCFS 2 VRWLFSTNHKDIGTLY IFGAIAGVMGTCFS Sbjct: 5 VRWLFSTNHKDIGTLYFIFGAIAGVMGTCFS 35