BLASTX nr result
ID: Zingiber25_contig00042546
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00042546 (265 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530359.1| conserved hypothetical protein [Ricinus comm... 56 4e-06 >ref|XP_002530359.1| conserved hypothetical protein [Ricinus communis] gi|223530106|gb|EEF32020.1| conserved hypothetical protein [Ricinus communis] Length = 453 Score = 56.2 bits (134), Expect = 4e-06 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 14/81 (17%) Frame = +1 Query: 58 RPQTMSSAHRSNDCHNGGDESG-CGRHCLSRCCLRQGTRLPLYCFSKVGKV--------- 207 R T+ S + ++ +GG +SG CGR+CL +CC+ QG +LPLY F +V K+ Sbjct: 11 RVPTVVSNFQKDEAEDGGKKSGGCGRNCLQKCCI-QGAKLPLYAFKRVDKIVSEKEVIEH 69 Query: 208 ---EPQANFLES-LFKQWDDR 258 EP FL+S L +W++R Sbjct: 70 ENTEPPVAFLDSLLLGEWEER 90