BLASTX nr result
ID: Zingiber25_contig00042523
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00042523 (432 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EOY31883.1| Pentatricopeptide repeat-containing protein, puta... 77 2e-12 ref|XP_002866609.1| pentatricopeptide repeat-containing protein ... 75 7e-12 ref|XP_002307901.1| predicted protein [Populus trichocarpa] 72 8e-11 ref|XP_006279545.1| hypothetical protein CARUB_v10028516mg [Caps... 70 4e-10 ref|NP_201237.1| pentatricopeptide repeat-containing protein [Ar... 70 4e-10 ref|XP_004301520.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_006487095.1| PREDICTED: pentatricopeptide repeat-containi... 67 2e-09 ref|XP_006423034.1| hypothetical protein CICLE_v10030202mg [Citr... 67 2e-09 ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 emb|CBI38482.3| unnamed protein product [Vitis vinifera] 67 3e-09 emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] 67 3e-09 ref|XP_004508428.1| PREDICTED: pentatricopeptide repeat-containi... 66 6e-09 ref|XP_006836883.1| hypothetical protein AMTR_s00099p00108770 [A... 65 7e-09 ref|XP_004163464.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_004139614.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-08 ref|XP_002510967.1| pentatricopeptide repeat-containing protein,... 64 2e-08 ref|XP_006352878.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_006352876.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_004245911.1| PREDICTED: pentatricopeptide repeat-containi... 63 4e-08 ref|XP_003617308.1| Auxin response factor [Medicago truncatula] ... 63 4e-08 >gb|EOY31883.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784628|gb|EOY31884.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] gi|508784629|gb|EOY31885.1| Pentatricopeptide repeat-containing protein, putative isoform 1 [Theobroma cacao] Length = 716 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = +1 Query: 283 SDGGRMETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 S + E+ENEWE+LLKPF+LDELR S N +TP +LCKLLELP+DVPTSL Sbjct: 33 SKSNQSESENEWERLLKPFDLDELRKSFNKITPYQLCKLLELPLDVPTSL 82 >ref|XP_002866609.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297312444|gb|EFH42868.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 724 Score = 75.5 bits (184), Expect = 7e-12 Identities = 45/89 (50%), Positives = 56/89 (62%), Gaps = 7/89 (7%) Frame = +1 Query: 187 MLKRIDLA------SVSFHKQTLLRSLSVNFLRRATGGSDGGRM-ETENEWEKLLKPFEL 345 ML R LA S S H+ + S F +GG DGG ++ NEWEKLLKPF+L Sbjct: 3 MLARSKLALDVSRRSHSLHRISYCAISSSGFC--GSGGDDGGGSPDSSNEWEKLLKPFDL 60 Query: 346 DELRNSMNFLTPARLCKLLELPIDVPTSL 432 D LRNS + +TP +LCKLLELP+DV TS+ Sbjct: 61 DSLRNSFHKITPFQLCKLLELPLDVSTSM 89 >ref|XP_002307901.1| predicted protein [Populus trichocarpa] Length = 724 Score = 72.0 bits (175), Expect = 8e-11 Identities = 42/88 (47%), Positives = 56/88 (63%), Gaps = 6/88 (6%) Frame = +1 Query: 187 MLKRIDLASVSFHKQTLLRSLSVN-----FLRRATG-GSDGGRMETENEWEKLLKPFELD 348 MLK LA VS Q +++ S++ F+R+ +G S E EWE+LLKPF+L Sbjct: 1 MLKGPKLAPVSKTLQIFIKTQSLSLFPSGFVRKFSGFNSKDNESAHETEWERLLKPFDLK 60 Query: 349 ELRNSMNFLTPARLCKLLELPIDVPTSL 432 ELR S N +TP +LCKLLELP+DV TS+ Sbjct: 61 ELRRSFNKITPFQLCKLLELPLDVETSM 88 >ref|XP_006279545.1| hypothetical protein CARUB_v10028516mg [Capsella rubella] gi|482548249|gb|EOA12443.1| hypothetical protein CARUB_v10028516mg [Capsella rubella] Length = 728 Score = 69.7 bits (169), Expect = 4e-10 Identities = 44/91 (48%), Positives = 57/91 (62%), Gaps = 9/91 (9%) Frame = +1 Query: 187 MLKRIDLA-SVSFHKQTLLRS-----LSVNFLRRAT---GGSDGGRMETENEWEKLLKPF 339 ML R LA +VS Q+LLR LS F G ++ G + NEWEKLLKPF Sbjct: 3 MLARSKLALNVSRRSQSLLRVSYYAVLSSGFCGGGDDVGGSTENGAAASANEWEKLLKPF 62 Query: 340 ELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 ++D LRNS++ +TP +L KLLELP+DV TS+ Sbjct: 63 DIDSLRNSIHKITPFQLYKLLELPLDVSTSM 93 >ref|NP_201237.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75171655|sp|Q9FMF6.1|PP444_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g64320, mitochondrial; Flags: Precursor gi|9759408|dbj|BAB09863.1| unnamed protein product [Arabidopsis thaliana] gi|332010486|gb|AED97869.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 730 Score = 69.7 bits (169), Expect = 4e-10 Identities = 48/95 (50%), Positives = 56/95 (58%), Gaps = 13/95 (13%) Frame = +1 Query: 187 MLKRIDLA-SVSFHKQTLLR-----SLSVNFLRRATGGSDGGRMETE-------NEWEKL 327 ML R LA VS Q+L R SLS F GG DGG E NEWEKL Sbjct: 3 MLARSKLALDVSRRSQSLQRICYYASLSSRF--SGGGGDDGGGSSPEIGGTDSANEWEKL 60 Query: 328 LKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 LKPF+LD LRNS + +TP +L KLLELP++V TS+ Sbjct: 61 LKPFDLDSLRNSFHKITPFQLYKLLELPLNVSTSM 95 >ref|XP_004301520.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 711 Score = 68.2 bits (165), Expect = 1e-09 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 2/70 (2%) Frame = +1 Query: 229 QTLLRS--LSVNFLRRATGGSDGGRMETENEWEKLLKPFELDELRNSMNFLTPARLCKLL 402 Q+L+++ LS +++ GSD E ENEWE+LLKPF+L+ELR S+ +TP +L KLL Sbjct: 16 QSLIKNPHLSAGYVK----GSDDSGSE-ENEWERLLKPFDLNELRKSLIQITPIQLSKLL 70 Query: 403 ELPIDVPTSL 432 ELP+DVPTSL Sbjct: 71 ELPLDVPTSL 80 >ref|XP_006487095.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Citrus sinensis] gi|568867543|ref|XP_006487096.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Citrus sinensis] Length = 728 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = +1 Query: 301 ETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 E+ENEWE+LLKPF+L+ELR S++ +TP +LCKLL LP+DV TS+ Sbjct: 55 ESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSM 98 >ref|XP_006423034.1| hypothetical protein CICLE_v10030202mg [Citrus clementina] gi|557524968|gb|ESR36274.1| hypothetical protein CICLE_v10030202mg [Citrus clementina] Length = 728 Score = 67.4 bits (163), Expect = 2e-09 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = +1 Query: 301 ETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 E+ENEWE+LLKPF+L+ELR S++ +TP +LCKLL LP+DV TS+ Sbjct: 55 ESENEWERLLKPFDLNELRKSLHKITPFQLCKLLRLPLDVDTSM 98 >ref|XP_003635427.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Vitis vinifera] Length = 740 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +1 Query: 274 TGGSDGGRMETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 T G D G EWE+LLKPF+L ELR S+ +TP +LCKLLELP+DVPTS+ Sbjct: 66 TNGLDSG-----TEWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDVPTSM 113 >emb|CBI38482.3| unnamed protein product [Vitis vinifera] Length = 368 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +1 Query: 274 TGGSDGGRMETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 T G D G EWE+LLKPF+L ELR S+ +TP +LCKLLELP+DVPTS+ Sbjct: 48 TNGLDSG-----TEWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDVPTSM 95 >emb|CAN67256.1| hypothetical protein VITISV_039434 [Vitis vinifera] Length = 722 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/53 (60%), Positives = 39/53 (73%) Frame = +1 Query: 274 TGGSDGGRMETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 T G D G EWE+LLKPF+L ELR S+ +TP +LCKLLELP+DVPTS+ Sbjct: 48 TNGLDSG-----TEWERLLKPFDLPELRTSLTRITPYQLCKLLELPLDVPTSM 95 >ref|XP_004508428.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Cicer arietinum] gi|502151414|ref|XP_004508429.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Cicer arietinum] gi|502151416|ref|XP_004508430.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X3 [Cicer arietinum] gi|502151418|ref|XP_004508431.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X4 [Cicer arietinum] Length = 712 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/44 (59%), Positives = 39/44 (88%) Frame = +1 Query: 301 ETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 E++ EWE++LKPF+L L+ S+N +TP++LCKLLELP+D+PTS+ Sbjct: 43 ESDTEWERVLKPFDLKHLQRSLNPITPSQLCKLLELPLDIPTSM 86 >ref|XP_006836883.1| hypothetical protein AMTR_s00099p00108770 [Amborella trichopoda] gi|548839447|gb|ERM99736.1| hypothetical protein AMTR_s00099p00108770 [Amborella trichopoda] Length = 712 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +1 Query: 295 RMETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 R +ENEWEK+LKPF L+ELR S N +TP RLCKLL LP+D+ SL Sbjct: 40 RSSSENEWEKILKPFGLEELRKSFNRITPQRLCKLLFLPLDLSLSL 85 >ref|XP_004163464.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Cucumis sativus] Length = 732 Score = 64.3 bits (155), Expect = 2e-08 Identities = 41/90 (45%), Positives = 54/90 (60%), Gaps = 7/90 (7%) Frame = +1 Query: 184 DMLKRIDLASVSFHKQTLL--RSLSVNFLRRATG-GSDGGRMETENE----WEKLLKPFE 342 +++KR S S K +L S +FL G GSD +M E+E WE LL+PF+ Sbjct: 7 NIVKRTKSLSSSESKIIILFENSCKASFLAGNIGDGSDPIKMNVESEPATEWESLLEPFD 66 Query: 343 LDELRNSMNFLTPARLCKLLELPIDVPTSL 432 L +LR S +TP +LCKLLELP+DVPT L Sbjct: 67 LTKLRKSRILITPVQLCKLLELPLDVPTLL 96 >ref|XP_004139614.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Cucumis sativus] Length = 732 Score = 63.9 bits (154), Expect = 2e-08 Identities = 41/90 (45%), Positives = 54/90 (60%), Gaps = 7/90 (7%) Frame = +1 Query: 184 DMLKRIDLASVSFHKQTLL--RSLSVNFLRRATG-GSDGGRMETENE----WEKLLKPFE 342 +++KR S S K +L S +FL G GSD +M E+E WE LL+PF+ Sbjct: 7 NIVKRTKSLSSSESKIIILFENSCKASFLAGNIGDGSDPIKMNVESEPATEWESLLEPFD 66 Query: 343 LDELRNSMNFLTPARLCKLLELPIDVPTSL 432 L +LR S +TP +LCKLLELP+DVPT L Sbjct: 67 LTKLRKSHILITPVQLCKLLELPLDVPTLL 96 >ref|XP_002510967.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223550082|gb|EEF51569.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 774 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/44 (65%), Positives = 35/44 (79%) Frame = +1 Query: 301 ETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 E E EWE+LLKPF+L ELR S N +TP +LCKLL LP+DV TS+ Sbjct: 43 ENETEWERLLKPFDLKELRRSFNQITPFQLCKLLLLPLDVSTSM 86 >ref|XP_006352878.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X3 [Solanum tuberosum] Length = 612 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = +1 Query: 289 GGRMETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 G E+ENEWE+LLKPF+ +L+ S+N +TP +L KLL LP+DVPTS+ Sbjct: 42 GDGSESENEWERLLKPFDFKQLQRSLNKITPYQLNKLLALPLDVPTSM 89 >ref|XP_006352876.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565372595|ref|XP_006352877.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 720 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = +1 Query: 289 GGRMETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 G E+ENEWE+LLKPF+ +L+ S+N +TP +L KLL LP+DVPTS+ Sbjct: 42 GDGSESENEWERLLKPFDFKQLQRSLNKITPYQLNKLLALPLDVPTSM 89 >ref|XP_004245911.1| PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Solanum lycopersicum] Length = 720 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/48 (58%), Positives = 38/48 (79%) Frame = +1 Query: 289 GGRMETENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 G E+ENEWE+LLKPF+ +L+ S+N +TP +L KLL LP+DVPTS+ Sbjct: 42 GDGSESENEWERLLKPFDFKQLQRSLNKITPYQLNKLLALPLDVPTSM 89 >ref|XP_003617308.1| Auxin response factor [Medicago truncatula] gi|355518643|gb|AET00267.1| Auxin response factor [Medicago truncatula] Length = 948 Score = 63.2 bits (152), Expect = 4e-08 Identities = 26/42 (61%), Positives = 36/42 (85%) Frame = +1 Query: 307 ENEWEKLLKPFELDELRNSMNFLTPARLCKLLELPIDVPTSL 432 + EWE LLKP++L L+ S+N +TP++LCKLLELP+DVPTS+ Sbjct: 37 DTEWENLLKPYDLKHLQRSLNPITPSQLCKLLELPLDVPTSM 78