BLASTX nr result
ID: Zingiber25_contig00042244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00042244 (278 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006659181.1| PREDICTED: G-type lectin S-receptor-like ser... 55 7e-06 >ref|XP_006659181.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase B120-like [Oryza brachyantha] Length = 840 Score = 55.5 bits (132), Expect = 7e-06 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 2/52 (3%) Frame = -2 Query: 277 NCSCTAYAYNNFDVG--NRTIQRCLVWMENMIDAEVYRSRGQDLYLKLMKLN 128 NCSC AYAY+N +G RCLVWM +ID E G+DLY+++ +LN Sbjct: 397 NCSCVAYAYSNISIGASEGDNTRCLVWMGELIDMEKVSQGGEDLYVRVTRLN 448