BLASTX nr result
ID: Zingiber25_contig00042170
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00042170 (401 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003578837.1| PREDICTED: probable alpha,alpha-trehalose-ph... 58 1e-06 dbj|BAJ94864.1| predicted protein [Hordeum vulgare subsp. vulgare] 58 1e-06 gb|EMS67437.1| putative alpha,alpha-trehalose-phosphate synthase... 57 3e-06 >ref|XP_003578837.1| PREDICTED: probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7-like [Brachypodium distachyon] Length = 877 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 VGQKPSQARFFLDDTNDVLNTLTALADASEQFVSPEK 111 VGQKPS+A+++LDDTNDVLN L ALADASE+ SPE+ Sbjct: 831 VGQKPSKAKYYLDDTNDVLNMLEALADASEEVGSPEE 867 >dbj|BAJ94864.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 869 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/37 (72%), Positives = 33/37 (89%) Frame = +1 Query: 1 VGQKPSQARFFLDDTNDVLNTLTALADASEQFVSPEK 111 VGQKPS+A+++LDDTNDVLN L ALADASE+ SPE+ Sbjct: 823 VGQKPSKAKYYLDDTNDVLNMLEALADASEEVGSPEE 859 >gb|EMS67437.1| putative alpha,alpha-trehalose-phosphate synthase [UDP-forming] 7 [Triticum urartu] Length = 986 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = +1 Query: 1 VGQKPSQARFFLDDTNDVLNTLTALADASEQFVSPEK 111 VGQKPS+A+++LDDTNDVLN L ALAD SE+ SPE+ Sbjct: 940 VGQKPSKAKYYLDDTNDVLNMLEALADVSEEVGSPEE 976