BLASTX nr result
ID: Zingiber25_contig00042121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00042121 (539 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFR45280.1| mitochondrial putative aminomethyltransferase, pa... 57 4e-06 gb|AFR45279.1| mitochondrial putative aminomethyltransferase, pa... 57 4e-06 gb|ABF69972.1| aminomethyltransferase, mitochondrial (glycine cl... 57 4e-06 >gb|AFR45280.1| mitochondrial putative aminomethyltransferase, partial [Musa acuminata AAA Group] Length = 152 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 447 PLSHLPEIFSYTGEDGFEISVPSENAVDLAK 539 P+S+LPEI SYTGEDGFEISVPSE+AVDL K Sbjct: 2 PVSNLPEIISYTGEDGFEISVPSEHAVDLTK 32 >gb|AFR45279.1| mitochondrial putative aminomethyltransferase, partial [Musa acuminata AAA Group] Length = 77 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 447 PLSHLPEIFSYTGEDGFEISVPSENAVDLAK 539 P+S+LPEI SYTGEDGFEISVPSE+AVDL K Sbjct: 2 PVSNLPEIISYTGEDGFEISVPSEHAVDLTK 32 >gb|ABF69972.1| aminomethyltransferase, mitochondrial (glycine cleavage system T protein), putative [Musa acuminata] Length = 424 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 447 PLSHLPEIFSYTGEDGFEISVPSENAVDLAK 539 P+S+LPEI SYTGEDGFEISVPSE+AVDL K Sbjct: 233 PVSNLPEIISYTGEDGFEISVPSEHAVDLTK 263