BLASTX nr result
ID: Zingiber25_contig00041783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00041783 (328 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006306165.1| hypothetical protein CARUB_v10011717mg [Caps... 55 1e-05 >ref|XP_006306165.1| hypothetical protein CARUB_v10011717mg [Capsella rubella] gi|482574876|gb|EOA39063.1| hypothetical protein CARUB_v10011717mg [Capsella rubella] Length = 448 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/49 (57%), Positives = 36/49 (73%) Frame = +2 Query: 182 LASNNVFA*PIVFVQVPAAGLLVQESLHELLVPDVRARSAAALDGLLPG 328 + +N +FA I+F QV + GL VQES +LVPDVR+ SAA+ DGLLPG Sbjct: 185 IVANVIFAYAIIFTQVVSVGLPVQESFPGVLVPDVRSSSAASRDGLLPG 233