BLASTX nr result
ID: Zingiber25_contig00041710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Zingiber25_contig00041710 (255 letters) Database: ./nr 37,332,560 sequences; 13,225,080,153 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006596204.1| PREDICTED: uncharacterized protein LOC100776... 55 9e-06 >ref|XP_006596204.1| PREDICTED: uncharacterized protein LOC100776432 [Glycine max] Length = 187 Score = 55.1 bits (131), Expect = 9e-06 Identities = 29/57 (50%), Positives = 36/57 (63%), Gaps = 6/57 (10%) Frame = -1 Query: 255 PKQTIVGVCALCLRERLLVLAANSEQ------KPLKQSKSSAIIGKVFALPSFYLSH 103 PKQ +VGVC LCL ERLL+LAAN + + Q K+SA I K+FAL S + H Sbjct: 18 PKQVVVGVCPLCLNERLLILAANQDHHHHHRLQSSTQRKASASIHKIFALGSLFTRH 74